Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1986169..1986389 Replicon chromosome
Accession NZ_CP014268
Organism Escherichia coli B strain C2566

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag C2566_RS09875 Protein ID WP_000170951.1
Coordinates 1986169..1986276 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1986326..1986389 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C2566_RS09850 1982015..1983097 + 1083 WP_000804726.1 peptide chain release factor 1 -
C2566_RS09855 1983097..1983930 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
C2566_RS09860 1983927..1984319 + 393 WP_000200373.1 invasion regulator SirB2 -
C2566_RS09865 1984323..1985132 + 810 WP_001257044.1 invasion regulator SirB1 -
C2566_RS09870 1985168..1986022 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C2566_RS09875 1986169..1986276 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1986326..1986389 + 64 NuclAT_32 - Antitoxin
- 1986326..1986389 + 64 NuclAT_32 - Antitoxin
- 1986326..1986389 + 64 NuclAT_32 - Antitoxin
- 1986326..1986389 + 64 NuclAT_32 - Antitoxin
- 1986326..1986389 + 64 NuclAT_35 - Antitoxin
- 1986326..1986389 + 64 NuclAT_35 - Antitoxin
- 1986326..1986389 + 64 NuclAT_35 - Antitoxin
- 1986326..1986389 + 64 NuclAT_35 - Antitoxin
- 1986326..1986389 + 64 NuclAT_38 - Antitoxin
- 1986326..1986389 + 64 NuclAT_38 - Antitoxin
- 1986326..1986389 + 64 NuclAT_38 - Antitoxin
- 1986326..1986389 + 64 NuclAT_38 - Antitoxin
- 1986326..1986389 + 64 NuclAT_41 - Antitoxin
- 1986326..1986389 + 64 NuclAT_41 - Antitoxin
- 1986326..1986389 + 64 NuclAT_41 - Antitoxin
- 1986326..1986389 + 64 NuclAT_41 - Antitoxin
- 1986326..1986389 + 64 NuclAT_47 - Antitoxin
- 1986326..1986389 + 64 NuclAT_47 - Antitoxin
- 1986326..1986389 + 64 NuclAT_47 - Antitoxin
- 1986326..1986389 + 64 NuclAT_47 - Antitoxin
- 1986326..1986389 + 64 NuclAT_50 - Antitoxin
- 1986326..1986389 + 64 NuclAT_50 - Antitoxin
- 1986326..1986389 + 64 NuclAT_50 - Antitoxin
- 1986326..1986389 + 64 NuclAT_50 - Antitoxin
C2566_RS09880 1986704..1986811 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1986859..1986924 + 66 NuclAT_30 - -
- 1986859..1986924 + 66 NuclAT_30 - -
- 1986859..1986924 + 66 NuclAT_30 - -
- 1986859..1986924 + 66 NuclAT_30 - -
- 1986859..1986924 + 66 NuclAT_33 - -
- 1986859..1986924 + 66 NuclAT_33 - -
- 1986859..1986924 + 66 NuclAT_33 - -
- 1986859..1986924 + 66 NuclAT_33 - -
- 1986859..1986924 + 66 NuclAT_36 - -
- 1986859..1986924 + 66 NuclAT_36 - -
- 1986859..1986924 + 66 NuclAT_36 - -
- 1986859..1986924 + 66 NuclAT_36 - -
- 1986859..1986924 + 66 NuclAT_39 - -
- 1986859..1986924 + 66 NuclAT_39 - -
- 1986859..1986924 + 66 NuclAT_39 - -
- 1986859..1986924 + 66 NuclAT_39 - -
- 1986859..1986924 + 66 NuclAT_45 - -
- 1986859..1986924 + 66 NuclAT_45 - -
- 1986859..1986924 + 66 NuclAT_45 - -
- 1986859..1986924 + 66 NuclAT_45 - -
- 1986859..1986924 + 66 NuclAT_48 - -
- 1986859..1986924 + 66 NuclAT_48 - -
- 1986859..1986924 + 66 NuclAT_48 - -
- 1986859..1986924 + 66 NuclAT_48 - -
- 1986859..1986926 + 68 NuclAT_16 - -
- 1986859..1986926 + 68 NuclAT_16 - -
- 1986859..1986926 + 68 NuclAT_16 - -
- 1986859..1986926 + 68 NuclAT_16 - -
- 1986859..1986926 + 68 NuclAT_18 - -
- 1986859..1986926 + 68 NuclAT_18 - -
- 1986859..1986926 + 68 NuclAT_18 - -
- 1986859..1986926 + 68 NuclAT_18 - -
- 1986859..1986926 + 68 NuclAT_20 - -
- 1986859..1986926 + 68 NuclAT_20 - -
- 1986859..1986926 + 68 NuclAT_20 - -
- 1986859..1986926 + 68 NuclAT_20 - -
- 1986859..1986926 + 68 NuclAT_22 - -
- 1986859..1986926 + 68 NuclAT_22 - -
- 1986859..1986926 + 68 NuclAT_22 - -
- 1986859..1986926 + 68 NuclAT_22 - -
- 1986859..1986926 + 68 NuclAT_24 - -
- 1986859..1986926 + 68 NuclAT_24 - -
- 1986859..1986926 + 68 NuclAT_24 - -
- 1986859..1986926 + 68 NuclAT_24 - -
- 1986859..1986926 + 68 NuclAT_26 - -
- 1986859..1986926 + 68 NuclAT_26 - -
- 1986859..1986926 + 68 NuclAT_26 - -
- 1986859..1986926 + 68 NuclAT_26 - -
C2566_RS09885 1987239..1987346 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1987394..1987459 + 66 NuclAT_31 - -
- 1987394..1987459 + 66 NuclAT_31 - -
- 1987394..1987459 + 66 NuclAT_31 - -
- 1987394..1987459 + 66 NuclAT_31 - -
- 1987394..1987459 + 66 NuclAT_34 - -
- 1987394..1987459 + 66 NuclAT_34 - -
- 1987394..1987459 + 66 NuclAT_34 - -
- 1987394..1987459 + 66 NuclAT_34 - -
- 1987394..1987459 + 66 NuclAT_37 - -
- 1987394..1987459 + 66 NuclAT_37 - -
- 1987394..1987459 + 66 NuclAT_37 - -
- 1987394..1987459 + 66 NuclAT_37 - -
- 1987394..1987459 + 66 NuclAT_40 - -
- 1987394..1987459 + 66 NuclAT_40 - -
- 1987394..1987459 + 66 NuclAT_40 - -
- 1987394..1987459 + 66 NuclAT_40 - -
- 1987394..1987459 + 66 NuclAT_46 - -
- 1987394..1987459 + 66 NuclAT_46 - -
- 1987394..1987459 + 66 NuclAT_46 - -
- 1987394..1987459 + 66 NuclAT_46 - -
- 1987394..1987459 + 66 NuclAT_49 - -
- 1987394..1987459 + 66 NuclAT_49 - -
- 1987394..1987459 + 66 NuclAT_49 - -
- 1987394..1987459 + 66 NuclAT_49 - -
- 1987394..1987461 + 68 NuclAT_15 - -
- 1987394..1987461 + 68 NuclAT_15 - -
- 1987394..1987461 + 68 NuclAT_15 - -
- 1987394..1987461 + 68 NuclAT_15 - -
- 1987394..1987461 + 68 NuclAT_17 - -
- 1987394..1987461 + 68 NuclAT_17 - -
- 1987394..1987461 + 68 NuclAT_17 - -
- 1987394..1987461 + 68 NuclAT_17 - -
- 1987394..1987461 + 68 NuclAT_19 - -
- 1987394..1987461 + 68 NuclAT_19 - -
- 1987394..1987461 + 68 NuclAT_19 - -
- 1987394..1987461 + 68 NuclAT_19 - -
- 1987394..1987461 + 68 NuclAT_21 - -
- 1987394..1987461 + 68 NuclAT_21 - -
- 1987394..1987461 + 68 NuclAT_21 - -
- 1987394..1987461 + 68 NuclAT_21 - -
- 1987394..1987461 + 68 NuclAT_23 - -
- 1987394..1987461 + 68 NuclAT_23 - -
- 1987394..1987461 + 68 NuclAT_23 - -
- 1987394..1987461 + 68 NuclAT_23 - -
- 1987394..1987461 + 68 NuclAT_25 - -
- 1987394..1987461 + 68 NuclAT_25 - -
- 1987394..1987461 + 68 NuclAT_25 - -
- 1987394..1987461 + 68 NuclAT_25 - -
C2566_RS09890 1987751..1988851 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
C2566_RS09895 1989121..1989351 + 231 WP_001146444.1 putative cation transport regulator ChaB -
C2566_RS09900 1989509..1990204 + 696 WP_012775986.1 glutathione-specific gamma-glutamylcyclotransferase -
C2566_RS09905 1990248..1990601 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T60465 WP_000170951.1 NZ_CP014268:c1986276-1986169 [Escherichia coli B]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T60465 NZ_CP014268:c1986276-1986169 [Escherichia coli B]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT60465 NZ_CP014268:1986326-1986389 [Escherichia coli B]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB E3PKK3


Antitoxin

Download structure file

References