Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4108627..4108849 Replicon chromosome
Accession NZ_CP014225
Organism Escherichia coli str. K-12 substr. MG1655 strain K-12

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag AW869_RS20310 Protein ID WP_000170963.1
Coordinates 4108627..4108734 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4108782..4108849 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AW869_RS20280 4103936..4105018 + 1083 WP_000804726.1 peptide chain release factor 1 -
AW869_RS20285 4105018..4105851 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
AW869_RS20290 4105848..4106240 + 393 WP_000200374.1 invasion regulator SirB2 -
AW869_RS20295 4106244..4107053 + 810 WP_001257044.1 invasion regulator SirB1 -
AW869_RS20300 4107089..4107943 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AW869_RS20305 4108092..4108199 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 4108247..4108313 + 67 NuclAT_34 - -
- 4108247..4108313 + 67 NuclAT_34 - -
- 4108247..4108313 + 67 NuclAT_34 - -
- 4108247..4108313 + 67 NuclAT_34 - -
- 4108247..4108313 + 67 NuclAT_36 - -
- 4108247..4108313 + 67 NuclAT_36 - -
- 4108247..4108313 + 67 NuclAT_36 - -
- 4108247..4108313 + 67 NuclAT_36 - -
- 4108247..4108313 + 67 NuclAT_38 - -
- 4108247..4108313 + 67 NuclAT_38 - -
- 4108247..4108313 + 67 NuclAT_38 - -
- 4108247..4108313 + 67 NuclAT_38 - -
- 4108247..4108313 + 67 NuclAT_40 - -
- 4108247..4108313 + 67 NuclAT_40 - -
- 4108247..4108313 + 67 NuclAT_40 - -
- 4108247..4108313 + 67 NuclAT_40 - -
- 4108247..4108313 + 67 NuclAT_42 - -
- 4108247..4108313 + 67 NuclAT_42 - -
- 4108247..4108313 + 67 NuclAT_42 - -
- 4108247..4108313 + 67 NuclAT_42 - -
- 4108247..4108313 + 67 NuclAT_44 - -
- 4108247..4108313 + 67 NuclAT_44 - -
- 4108247..4108313 + 67 NuclAT_44 - -
- 4108247..4108313 + 67 NuclAT_44 - -
- 4108249..4108314 + 66 NuclAT_18 - -
- 4108249..4108314 + 66 NuclAT_18 - -
- 4108249..4108314 + 66 NuclAT_18 - -
- 4108249..4108314 + 66 NuclAT_18 - -
- 4108249..4108314 + 66 NuclAT_21 - -
- 4108249..4108314 + 66 NuclAT_21 - -
- 4108249..4108314 + 66 NuclAT_21 - -
- 4108249..4108314 + 66 NuclAT_21 - -
- 4108249..4108314 + 66 NuclAT_24 - -
- 4108249..4108314 + 66 NuclAT_24 - -
- 4108249..4108314 + 66 NuclAT_24 - -
- 4108249..4108314 + 66 NuclAT_24 - -
- 4108249..4108314 + 66 NuclAT_27 - -
- 4108249..4108314 + 66 NuclAT_27 - -
- 4108249..4108314 + 66 NuclAT_27 - -
- 4108249..4108314 + 66 NuclAT_27 - -
- 4108249..4108314 + 66 NuclAT_30 - -
- 4108249..4108314 + 66 NuclAT_30 - -
- 4108249..4108314 + 66 NuclAT_30 - -
- 4108249..4108314 + 66 NuclAT_30 - -
- 4108249..4108314 + 66 NuclAT_33 - -
- 4108249..4108314 + 66 NuclAT_33 - -
- 4108249..4108314 + 66 NuclAT_33 - -
- 4108249..4108314 + 66 NuclAT_33 - -
AW869_RS20310 4108627..4108734 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 4108782..4108849 + 68 NuclAT_17 - Antitoxin
- 4108782..4108849 + 68 NuclAT_17 - Antitoxin
- 4108782..4108849 + 68 NuclAT_17 - Antitoxin
- 4108782..4108849 + 68 NuclAT_17 - Antitoxin
- 4108782..4108849 + 68 NuclAT_20 - Antitoxin
- 4108782..4108849 + 68 NuclAT_20 - Antitoxin
- 4108782..4108849 + 68 NuclAT_20 - Antitoxin
- 4108782..4108849 + 68 NuclAT_20 - Antitoxin
- 4108782..4108849 + 68 NuclAT_23 - Antitoxin
- 4108782..4108849 + 68 NuclAT_23 - Antitoxin
- 4108782..4108849 + 68 NuclAT_23 - Antitoxin
- 4108782..4108849 + 68 NuclAT_23 - Antitoxin
- 4108782..4108849 + 68 NuclAT_26 - Antitoxin
- 4108782..4108849 + 68 NuclAT_26 - Antitoxin
- 4108782..4108849 + 68 NuclAT_26 - Antitoxin
- 4108782..4108849 + 68 NuclAT_26 - Antitoxin
- 4108782..4108849 + 68 NuclAT_29 - Antitoxin
- 4108782..4108849 + 68 NuclAT_29 - Antitoxin
- 4108782..4108849 + 68 NuclAT_29 - Antitoxin
- 4108782..4108849 + 68 NuclAT_29 - Antitoxin
- 4108782..4108849 + 68 NuclAT_32 - Antitoxin
- 4108782..4108849 + 68 NuclAT_32 - Antitoxin
- 4108782..4108849 + 68 NuclAT_32 - Antitoxin
- 4108782..4108849 + 68 NuclAT_32 - Antitoxin
- 4108783..4108848 + 66 NuclAT_35 - -
- 4108783..4108848 + 66 NuclAT_35 - -
- 4108783..4108848 + 66 NuclAT_35 - -
- 4108783..4108848 + 66 NuclAT_35 - -
- 4108783..4108848 + 66 NuclAT_37 - -
- 4108783..4108848 + 66 NuclAT_37 - -
- 4108783..4108848 + 66 NuclAT_37 - -
- 4108783..4108848 + 66 NuclAT_37 - -
- 4108783..4108848 + 66 NuclAT_39 - -
- 4108783..4108848 + 66 NuclAT_39 - -
- 4108783..4108848 + 66 NuclAT_39 - -
- 4108783..4108848 + 66 NuclAT_39 - -
- 4108783..4108848 + 66 NuclAT_41 - -
- 4108783..4108848 + 66 NuclAT_41 - -
- 4108783..4108848 + 66 NuclAT_41 - -
- 4108783..4108848 + 66 NuclAT_41 - -
- 4108783..4108848 + 66 NuclAT_43 - -
- 4108783..4108848 + 66 NuclAT_43 - -
- 4108783..4108848 + 66 NuclAT_43 - -
- 4108783..4108848 + 66 NuclAT_43 - -
- 4108783..4108848 + 66 NuclAT_45 - -
- 4108783..4108848 + 66 NuclAT_45 - -
- 4108783..4108848 + 66 NuclAT_45 - -
- 4108783..4108848 + 66 NuclAT_45 - -
AW869_RS20315 4109162..4109269 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 4109317..4109384 + 68 NuclAT_16 - -
- 4109317..4109384 + 68 NuclAT_16 - -
- 4109317..4109384 + 68 NuclAT_16 - -
- 4109317..4109384 + 68 NuclAT_16 - -
- 4109317..4109384 + 68 NuclAT_19 - -
- 4109317..4109384 + 68 NuclAT_19 - -
- 4109317..4109384 + 68 NuclAT_19 - -
- 4109317..4109384 + 68 NuclAT_19 - -
- 4109317..4109384 + 68 NuclAT_22 - -
- 4109317..4109384 + 68 NuclAT_22 - -
- 4109317..4109384 + 68 NuclAT_22 - -
- 4109317..4109384 + 68 NuclAT_22 - -
- 4109317..4109384 + 68 NuclAT_25 - -
- 4109317..4109384 + 68 NuclAT_25 - -
- 4109317..4109384 + 68 NuclAT_25 - -
- 4109317..4109384 + 68 NuclAT_25 - -
- 4109317..4109384 + 68 NuclAT_28 - -
- 4109317..4109384 + 68 NuclAT_28 - -
- 4109317..4109384 + 68 NuclAT_28 - -
- 4109317..4109384 + 68 NuclAT_28 - -
- 4109317..4109384 + 68 NuclAT_31 - -
- 4109317..4109384 + 68 NuclAT_31 - -
- 4109317..4109384 + 68 NuclAT_31 - -
- 4109317..4109384 + 68 NuclAT_31 - -
AW869_RS20320 4109673..4110773 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
AW869_RS20325 4111043..4111273 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AW869_RS20330 4111431..4112126 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
AW869_RS20335 4112170..4112523 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T60402 WP_000170963.1 NZ_CP014225:c4108734-4108627 [Escherichia coli str. K-12 substr. MG1655]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T60402 NZ_CP014225:c4108734-4108627 [Escherichia coli str. K-12 substr. MG1655]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT60402 NZ_CP014225:4108782-4108849 [Escherichia coli str. K-12 substr. MG1655]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References