Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1897180..1897402 | Replicon | chromosome |
Accession | NZ_CP014225 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | AW869_RS09365 | Protein ID | WP_000141634.1 |
Coordinates | 1897180..1897287 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1897336..1897402 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AW869_RS09340 | 1892433..1893185 | - | 753 | Protein_1782 | cellulose biosynthesis protein BcsQ | - |
AW869_RS09345 | 1893197..1893385 | - | 189 | WP_001063318.1 | YhjR family protein | - |
AW869_RS09350 | 1893658..1895229 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
AW869_RS09355 | 1895226..1895417 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
AW869_RS09360 | 1895414..1897093 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
AW869_RS09365 | 1897180..1897287 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 1897336..1897402 | + | 67 | - | - | Antitoxin |
AW869_RS09375 | 1897763..1899034 | + | 1272 | WP_001295225.1 | transporter | - |
AW869_RS09380 | 1899064..1900068 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
AW869_RS09385 | 1900065..1901048 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
AW869_RS09390 | 1901059..1901961 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T60389 WP_000141634.1 NZ_CP014225:c1897287-1897180 [Escherichia coli str. K-12 substr. MG1655]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T60389 NZ_CP014225:c1897287-1897180 [Escherichia coli str. K-12 substr. MG1655]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT60389 NZ_CP014225:1897336-1897402 [Escherichia coli str. K-12 substr. MG1655]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|