Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 484158..484315 | Replicon | chromosome |
| Accession | NZ_CP014113 | ||
| Organism | Staphylococcus saprophyticus strain FDAARGOS_168 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AL528_RS13135 | Protein ID | WP_002441941.1 |
| Coordinates | 484220..484315 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 484158..484191 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AL528_RS02415 | 479945..480778 | + | 834 | WP_048787569.1 | aldo/keto reductase | - |
| AL528_RS02420 | 481245..481544 | - | 300 | WP_011304021.1 | hypothetical protein | - |
| AL528_RS02425 | 481921..482154 | + | 234 | WP_048787568.1 | ferrous iron transport protein A | - |
| AL528_RS13130 | 482215..482280 | - | 66 | WP_162009580.1 | type I toxin-antitoxin system Fst family toxin | - |
| AL528_RS02430 | 482468..483862 | - | 1395 | WP_048787567.1 | RES family NAD+ phosphorylase | - |
| - | 484158..484191 | + | 34 | - | - | Antitoxin |
| AL528_RS13135 | 484220..484315 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| AL528_RS02435 | 484618..485376 | - | 759 | WP_011304024.1 | MerR family transcriptional regulator | - |
| AL528_RS02440 | 485486..486049 | - | 564 | WP_048787566.1 | helix-turn-helix domain-containing protein | - |
| AL528_RS02445 | 486243..487700 | - | 1458 | WP_011304026.1 | carbon starvation protein A | - |
| AL528_RS02450 | 487908..488747 | - | 840 | WP_002481957.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T60184 WP_002441941.1 NZ_CP014113:c484315-484220 [Staphylococcus saprophyticus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T60184 NZ_CP014113:c484315-484220 [Staphylococcus saprophyticus]
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTATTTTACTTATTGGCTTAGTAG
TAAACGCAATAAATAG
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTATTTTACTTATTGGCTTAGTAG
TAAACGCAATAAATAG
Antitoxin
Download Length: 34 bp
>AT60184 NZ_CP014113:484158-484191 [Staphylococcus saprophyticus]
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|