Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3102287..3102509 | Replicon | chromosome |
| Accession | NZ_CP014111 | ||
| Organism | Escherichia coli strain FDAARGOS_144 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A3K0NFU8 |
| Locus tag | AL502_RS26330 | Protein ID | WP_000170748.1 |
| Coordinates | 3102287..3102394 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3102451..3102509 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AL502_RS16945 | 3097822..3098010 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| AL502_RS16950 | 3098283..3099854 | + | 1572 | WP_001204941.1 | cellulose biosynthesis protein BcsE | - |
| AL502_RS16955 | 3099851..3100042 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| AL502_RS16960 | 3100039..3101718 | + | 1680 | WP_022296260.1 | cellulose biosynthesis protein BcsG | - |
| AL502_RS16965 | 3101804..3101911 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| AL502_RS26330 | 3102287..3102394 | - | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3102451..3102509 | + | 59 | - | - | Antitoxin |
| AL502_RS26335 | 3102770..3102877 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| AL502_RS16990 | 3103353..3104624 | + | 1272 | WP_001296513.1 | amino acid permease | - |
| AL502_RS16995 | 3104654..3105658 | - | 1005 | WP_000103571.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| AL502_RS17000 | 3105655..3106638 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3913.76 Da Isoelectric Point: 9.0157
>T60164 WP_000170748.1 NZ_CP014111:c3102394-3102287 [Escherichia coli]
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
Download Length: 108 bp
>T60164 NZ_CP014111:c3102394-3102287 [Escherichia coli]
ATGACGCTCGCAGAGTTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTACTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGTTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTACTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT60164 NZ_CP014111:3102451-3102509 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|