Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1051727..1051907 | Replicon | chromosome |
| Accession | NZ_CP014064 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_159 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AL519_RS14815 | Protein ID | WP_001801861.1 |
| Coordinates | 1051727..1051822 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1051850..1051907 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AL519_RS05540 | 1046890..1047540 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| AL519_RS05545 | 1047621..1048616 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| AL519_RS05550 | 1048691..1049317 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| AL519_RS05555 | 1049358..1049699 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| AL519_RS05560 | 1049800..1050372 | + | 573 | WP_061047279.1 | hypothetical protein | - |
| AL519_RS05565 | 1050570..1051582 | - | 1013 | Protein_1022 | IS3 family transposase | - |
| AL519_RS14815 | 1051727..1051822 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1051850..1051907 | - | 58 | - | - | Antitoxin |
| AL519_RS05570 | 1051945..1052046 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| AL519_RS05575 | 1052024..1052185 | - | 162 | Protein_1025 | transposase | - |
| AL519_RS05580 | 1052176..1052670 | - | 495 | Protein_1026 | transposase | - |
| AL519_RS05585 | 1053122..1054351 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| AL519_RS05590 | 1054344..1055900 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| AL519_RS05595 | 1056064..1056198 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1046132..1097985 | 51853 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T60063 WP_001801861.1 NZ_CP014064:1051727-1051822 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T60063 NZ_CP014064:1051727-1051822 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT60063 NZ_CP014064:c1051907-1051850 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|