Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2000999..2001179 | Replicon | chromosome |
Accession | NZ_CP013955 | ||
Organism | Staphylococcus aureus strain NCCP14562 isolate Sequencing |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ASL15_RS15725 | Protein ID | WP_001801861.1 |
Coordinates | 2000999..2001094 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2001122..2001179 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASL15_RS09860 | 1996162..1996812 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
ASL15_RS09865 | 1996893..1997888 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
ASL15_RS09870 | 1997963..1998589 | + | 627 | WP_000669024.1 | hypothetical protein | - |
ASL15_RS09875 | 1998630..1998971 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
ASL15_RS09880 | 1999072..1999644 | + | 573 | WP_000414216.1 | hypothetical protein | - |
ASL15_RS15310 | 1999842..2000854 | - | 1013 | Protein_1914 | IS3 family transposase | - |
ASL15_RS15725 | 2000999..2001094 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2001122..2001179 | - | 58 | - | - | Antitoxin |
ASL15_RS09900 | 2001217..2001318 | + | 102 | WP_001792025.1 | hypothetical protein | - |
ASL15_RS15730 | 2001296..2001457 | - | 162 | Protein_1917 | transposase | - |
ASL15_RS09905 | 2001448..2001942 | - | 495 | Protein_1918 | transposase | - |
ASL15_RS09910 | 2002394..2003623 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
ASL15_RS09915 | 2003616..2005172 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
ASL15_RS09920 | 2005336..2005470 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1995404..2048745 | 53341 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T59698 WP_001801861.1 NZ_CP013955:2000999-2001094 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T59698 NZ_CP013955:2000999-2001094 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT59698 NZ_CP013955:c2001179-2001122 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|