Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2639428..2639612 | Replicon | chromosome |
Accession | NZ_CP013953 | ||
Organism | Staphylococcus aureus strain NCCP14558 isolate sequencing |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | ASL16_RS13555 | Protein ID | WP_000482652.1 |
Coordinates | 2639505..2639612 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2639428..2639488 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASL16_RS13530 | 2634883..2635050 | - | 168 | Protein_2577 | hypothetical protein | - |
ASL16_RS13540 | 2635281..2637014 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
ASL16_RS13545 | 2637039..2638802 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2639428..2639488 | + | 61 | - | - | Antitoxin |
ASL16_RS13555 | 2639505..2639612 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ASL16_RS13560 | 2639746..2640132 | - | 387 | WP_000779360.1 | flippase GtxA | - |
ASL16_RS13565 | 2640400..2641542 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
ASL16_RS13570 | 2641602..2642261 | + | 660 | WP_000831298.1 | membrane protein | - |
ASL16_RS13575 | 2642443..2643654 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
ASL16_RS13580 | 2643777..2644250 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T59690 WP_000482652.1 NZ_CP013953:c2639612-2639505 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T59690 NZ_CP013953:c2639612-2639505 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT59690 NZ_CP013953:2639428-2639488 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|