Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 72182..72330 | Replicon | chromosome |
Accession | NZ_CP013911 | ||
Organism | Staphylococcus haemolyticus strain S167 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | AV904_RS12555 | Protein ID | WP_011276848.1 |
Coordinates | 72182..72277 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 72295..72330 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AV904_RS00315 | 68249..68566 | - | 318 | Protein_62 | IS200/IS605-like element ISSep3 family transposase | - |
AV904_RS00325 | 69367..69516 | + | 150 | WP_062931900.1 | hypothetical protein | - |
AV904_RS00330 | 70122..70652 | + | 531 | WP_053038729.1 | N-acetyltransferase | - |
AV904_RS00335 | 70891..71274 | + | 384 | WP_011276846.1 | effector binding domain-containing protein | - |
AV904_RS00340 | 71413..71717 | + | 305 | Protein_66 | hypothetical protein | - |
AV904_RS12710 | 71739..71987 | + | 249 | WP_002440480.1 | hypothetical protein | - |
AV904_RS12555 | 72182..72277 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 72295..72330 | + | 36 | - | - | Antitoxin |
AV904_RS00345 | 72416..73624 | - | 1209 | WP_053021807.1 | hypothetical protein | - |
AV904_RS00350 | 73801..74436 | - | 636 | WP_053021806.1 | HXXEE domain-containing protein | - |
AV904_RS00355 | 74438..75085 | - | 648 | WP_053021805.1 | TetR/AcrR family transcriptional regulator | - |
AV904_RS00360 | 75105..75755 | - | 651 | WP_053021804.1 | HXXEE domain-containing protein | - |
AV904_RS00365 | 76014..76592 | + | 579 | WP_037559009.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T59566 WP_011276848.1 NZ_CP013911:72182-72277 [Staphylococcus haemolyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T59566 NZ_CP013911:72182-72277 [Staphylococcus haemolyticus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT59566 NZ_CP013911:72295-72330 [Staphylococcus haemolyticus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|