Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40452..40705 | Replicon | plasmid pJJ2434_2 |
| Accession | NZ_CP013834 | ||
| Organism | Escherichia coli strain JJ2434 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | AVR68_RS26800 | Protein ID | WP_001312851.1 |
| Coordinates | 40452..40601 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 40646..40705 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AVR68_RS00990 | 36427..37093 | + | 667 | Protein_55 | hypothetical protein | - |
| AVR68_RS00995 | 37129..37428 | - | 300 | WP_001528606.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| AVR68_RS01000 | 37418..37681 | - | 264 | WP_001089473.1 | hypothetical protein | - |
| AVR68_RS28950 | 37788..38048 | - | 261 | WP_019842130.1 | hypothetical protein | - |
| AVR68_RS01010 | 38750..39607 | - | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| AVR68_RS27020 | 39600..39674 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| AVR68_RS01020 | 39919..40167 | - | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| AVR68_RS26800 | 40452..40601 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 40646..40705 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 40646..40705 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 40646..40705 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 40646..40705 | + | 60 | NuclAT_1 | - | Antitoxin |
| AVR68_RS01025 | 40848..41321 | - | 474 | WP_016240489.1 | hypothetical protein | - |
| AVR68_RS01030 | 41475..42065 | - | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| AVR68_RS27040 | 42103..42312 | - | 210 | WP_071888758.1 | hemolysin expression modulator Hha | - |
| AVR68_RS01035 | 42381..42818 | - | 438 | Protein_66 | thermonuclease family protein | - |
| AVR68_RS01040 | 43063..43275 | - | 213 | WP_052983100.1 | ANR family transcriptional regulator | - |
| AVR68_RS01045 | 43408..43969 | - | 562 | Protein_68 | fertility inhibition protein FinO | - |
| AVR68_RS01050 | 44024..44770 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..62183 | 62183 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T59433 WP_001312851.1 NZ_CP013834:c40601-40452 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T59433 NZ_CP013834:c40601-40452 [Escherichia coli]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT59433 NZ_CP013834:40646-40705 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|