Detailed information of TA system TA059389

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1463762..1463983
• Replicon: chromosome
• Accession: NZ_CP013831
• Organism: Escherichia coli strain CD306

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: AVR67_RS07545
• Protein ID: WP_001531632.1
• Coordinates: 1463762..1463869 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1463917..1463983 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AVR67_RS07520	1459606..1460688	+	1083	WP_000804726.1	peptide chain release factor 1	-
AVR67_RS07525	1460688..1461521	+	834	WP_000456450.1	peptide chain release factor N(5)-glutamine methyltransferase	-
AVR67_RS07530	1461518..1461910	+	393	WP_000200375.1	invasion regulator SirB2	-
AVR67_RS07535	1461914..1462723	+	810	WP_001257044.1	invasion regulator SirB1	-
AVR67_RS07540	1462759..1463613	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
AVR67_RS07545	1463762..1463869	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1463917..1463983	+	67	NuclAT_10	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_10	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_10	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_10	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_5	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_5	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_5	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_5	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_6	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_6	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_6	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_6	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_7	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_7	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_7	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_7	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_8	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_8	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_8	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_8	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_9	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_9	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_9	-	Antitoxin
-	1463917..1463983	+	67	NuclAT_9	-	Antitoxin
-	1463919..1463982	+	64	NuclAT_12	-	-
-	1463919..1463982	+	64	NuclAT_12	-	-
-	1463919..1463982	+	64	NuclAT_12	-	-
-	1463919..1463982	+	64	NuclAT_12	-	-
-	1463919..1463982	+	64	NuclAT_13	-	-
-	1463919..1463982	+	64	NuclAT_13	-	-
-	1463919..1463982	+	64	NuclAT_13	-	-
-	1463919..1463982	+	64	NuclAT_13	-	-
-	1463919..1463982	+	64	NuclAT_14	-	-
-	1463919..1463982	+	64	NuclAT_14	-	-
-	1463919..1463982	+	64	NuclAT_14	-	-
-	1463919..1463982	+	64	NuclAT_14	-	-
-	1463919..1463982	+	64	NuclAT_15	-	-
-	1463919..1463982	+	64	NuclAT_15	-	-
-	1463919..1463982	+	64	NuclAT_15	-	-
-	1463919..1463982	+	64	NuclAT_15	-	-
-	1463919..1463982	+	64	NuclAT_16	-	-
-	1463919..1463982	+	64	NuclAT_16	-	-
-	1463919..1463982	+	64	NuclAT_16	-	-
-	1463919..1463982	+	64	NuclAT_16	-	-
-	1463919..1463982	+	64	NuclAT_17	-	-
-	1463919..1463982	+	64	NuclAT_17	-	-
-	1463919..1463982	+	64	NuclAT_17	-	-
-	1463919..1463982	+	64	NuclAT_17	-	-
-	1463919..1463984	+	66	NuclAT_18	-	-
-	1463919..1463984	+	66	NuclAT_18	-	-
-	1463919..1463984	+	66	NuclAT_18	-	-
-	1463919..1463984	+	66	NuclAT_18	-	-
-	1463919..1463984	+	66	NuclAT_19	-	-
-	1463919..1463984	+	66	NuclAT_19	-	-
-	1463919..1463984	+	66	NuclAT_19	-	-
-	1463919..1463984	+	66	NuclAT_19	-	-
-	1463919..1463984	+	66	NuclAT_20	-	-
-	1463919..1463984	+	66	NuclAT_20	-	-
-	1463919..1463984	+	66	NuclAT_20	-	-
-	1463919..1463984	+	66	NuclAT_20	-	-
-	1463919..1463984	+	66	NuclAT_21	-	-
-	1463919..1463984	+	66	NuclAT_21	-	-
-	1463919..1463984	+	66	NuclAT_21	-	-
-	1463919..1463984	+	66	NuclAT_21	-	-
-	1463919..1463984	+	66	NuclAT_22	-	-
-	1463919..1463984	+	66	NuclAT_22	-	-
-	1463919..1463984	+	66	NuclAT_22	-	-
-	1463919..1463984	+	66	NuclAT_22	-	-
-	1463919..1463984	+	66	NuclAT_23	-	-
-	1463919..1463984	+	66	NuclAT_23	-	-
-	1463919..1463984	+	66	NuclAT_23	-	-
-	1463919..1463984	+	66	NuclAT_23	-	-
AVR67_RS07550	1464274..1465140	-	867	Protein_1457	sodium-potassium/proton antiporter ChaA	-
AVR67_RS07555	1465158..1465855	-	698	Protein_1458	IS1 family transposase	-
AVR67_RS07560	1465912..1466151	-	240	Protein_1459	sodium-potassium/proton antiporter ChaA	-
AVR67_RS07565	1466421..1466660	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
AVR67_RS07570	1466809..1467504	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
AVR67_RS07575	1467548..1467901	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T59389 WP_001531632.1 NZ_CP013831:c1463869-1463762 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T59389 NZ_CP013831:c1463869-1463762 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT59389 NZ_CP013831:1463917-1463983 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin