Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-symR/Ldr(toxin) |
| Location | 1441592..1441813 | Replicon | chromosome |
| Accession | NZ_CP013662 | ||
| Organism | Escherichia coli strain 08-00022 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A2Y8S137 |
| Locus tag | CP48_RS08780 | Protein ID | WP_000170957.1 |
| Coordinates | 1441592..1441699 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 1441747..1441813 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CP48_RS08755 | 1437436..1438518 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| CP48_RS08760 | 1438518..1439351 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CP48_RS08765 | 1439348..1439740 | + | 393 | WP_001409175.1 | invasion regulator SirB2 | - |
| CP48_RS08770 | 1439744..1440553 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| CP48_RS08775 | 1440589..1441443 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| CP48_RS08780 | 1441592..1441699 | - | 108 | WP_000170957.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1441747..1441813 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1441747..1441813 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1441749..1441812 | + | 64 | NuclAT_27 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_27 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_27 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_27 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_29 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_29 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_29 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_29 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_31 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_31 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_31 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_31 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_33 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_33 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_33 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_33 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_35 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_35 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_35 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_35 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_37 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_37 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_37 | - | - |
| - | 1441749..1441812 | + | 64 | NuclAT_37 | - | - |
| CP48_RS08785 | 1442127..1442234 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1442287..1442348 | + | 62 | NuclAT_26 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_26 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_26 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_26 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_28 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_28 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_28 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_28 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_30 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_30 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_30 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_30 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_32 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_32 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_32 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_32 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_34 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_34 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_34 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_34 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_36 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_36 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_36 | - | - |
| - | 1442287..1442348 | + | 62 | NuclAT_36 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_15 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_15 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_15 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_15 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_17 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_17 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_17 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_17 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_19 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_19 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_19 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_19 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_21 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_21 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_21 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_21 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_23 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_23 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_23 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_23 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_25 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_25 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_25 | - | - |
| - | 1442287..1442349 | + | 63 | NuclAT_25 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_38 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_38 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_38 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_38 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_39 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_39 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_39 | - | - |
| - | 1442287..1442350 | + | 64 | NuclAT_39 | - | - |
| CP48_RS08790 | 1442640..1443740 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| CP48_RS08795 | 1444010..1444240 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| CP48_RS08800 | 1444398..1445093 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| CP48_RS08805 | 1445137..1445490 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T59116 WP_000170957.1 NZ_CP013662:c1441699-1441592 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGITTAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGITTAAIVGWWRNRK
Download Length: 108 bp
>T59116 NZ_CP013662:c1441699-1441592 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTACTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTACTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT59116 NZ_CP013662:1441747-1441813 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|