Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-symR/Ldr(toxin)
Location 1441592..1441813 Replicon chromosome
Accession NZ_CP013662
Organism Escherichia coli strain 08-00022

Toxin (Protein)


Gene name ldrD Uniprot ID A0A2Y8S137
Locus tag CP48_RS08780 Protein ID WP_000170957.1
Coordinates 1441592..1441699 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name symR
Locus tag -
Coordinates 1441747..1441813 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CP48_RS08755 1437436..1438518 + 1083 WP_000804726.1 peptide chain release factor 1 -
CP48_RS08760 1438518..1439351 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
CP48_RS08765 1439348..1439740 + 393 WP_001409175.1 invasion regulator SirB2 -
CP48_RS08770 1439744..1440553 + 810 WP_001257044.1 invasion regulator SirB1 -
CP48_RS08775 1440589..1441443 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CP48_RS08780 1441592..1441699 - 108 WP_000170957.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1441747..1441813 + 67 NuclAT_14 - Antitoxin
- 1441747..1441813 + 67 NuclAT_14 - Antitoxin
- 1441747..1441813 + 67 NuclAT_14 - Antitoxin
- 1441747..1441813 + 67 NuclAT_14 - Antitoxin
- 1441747..1441813 + 67 NuclAT_16 - Antitoxin
- 1441747..1441813 + 67 NuclAT_16 - Antitoxin
- 1441747..1441813 + 67 NuclAT_16 - Antitoxin
- 1441747..1441813 + 67 NuclAT_16 - Antitoxin
- 1441747..1441813 + 67 NuclAT_18 - Antitoxin
- 1441747..1441813 + 67 NuclAT_18 - Antitoxin
- 1441747..1441813 + 67 NuclAT_18 - Antitoxin
- 1441747..1441813 + 67 NuclAT_18 - Antitoxin
- 1441747..1441813 + 67 NuclAT_20 - Antitoxin
- 1441747..1441813 + 67 NuclAT_20 - Antitoxin
- 1441747..1441813 + 67 NuclAT_20 - Antitoxin
- 1441747..1441813 + 67 NuclAT_20 - Antitoxin
- 1441747..1441813 + 67 NuclAT_22 - Antitoxin
- 1441747..1441813 + 67 NuclAT_22 - Antitoxin
- 1441747..1441813 + 67 NuclAT_22 - Antitoxin
- 1441747..1441813 + 67 NuclAT_22 - Antitoxin
- 1441747..1441813 + 67 NuclAT_24 - Antitoxin
- 1441747..1441813 + 67 NuclAT_24 - Antitoxin
- 1441747..1441813 + 67 NuclAT_24 - Antitoxin
- 1441747..1441813 + 67 NuclAT_24 - Antitoxin
- 1441749..1441812 + 64 NuclAT_27 - -
- 1441749..1441812 + 64 NuclAT_27 - -
- 1441749..1441812 + 64 NuclAT_27 - -
- 1441749..1441812 + 64 NuclAT_27 - -
- 1441749..1441812 + 64 NuclAT_29 - -
- 1441749..1441812 + 64 NuclAT_29 - -
- 1441749..1441812 + 64 NuclAT_29 - -
- 1441749..1441812 + 64 NuclAT_29 - -
- 1441749..1441812 + 64 NuclAT_31 - -
- 1441749..1441812 + 64 NuclAT_31 - -
- 1441749..1441812 + 64 NuclAT_31 - -
- 1441749..1441812 + 64 NuclAT_31 - -
- 1441749..1441812 + 64 NuclAT_33 - -
- 1441749..1441812 + 64 NuclAT_33 - -
- 1441749..1441812 + 64 NuclAT_33 - -
- 1441749..1441812 + 64 NuclAT_33 - -
- 1441749..1441812 + 64 NuclAT_35 - -
- 1441749..1441812 + 64 NuclAT_35 - -
- 1441749..1441812 + 64 NuclAT_35 - -
- 1441749..1441812 + 64 NuclAT_35 - -
- 1441749..1441812 + 64 NuclAT_37 - -
- 1441749..1441812 + 64 NuclAT_37 - -
- 1441749..1441812 + 64 NuclAT_37 - -
- 1441749..1441812 + 64 NuclAT_37 - -
CP48_RS08785 1442127..1442234 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1442287..1442348 + 62 NuclAT_26 - -
- 1442287..1442348 + 62 NuclAT_26 - -
- 1442287..1442348 + 62 NuclAT_26 - -
- 1442287..1442348 + 62 NuclAT_26 - -
- 1442287..1442348 + 62 NuclAT_28 - -
- 1442287..1442348 + 62 NuclAT_28 - -
- 1442287..1442348 + 62 NuclAT_28 - -
- 1442287..1442348 + 62 NuclAT_28 - -
- 1442287..1442348 + 62 NuclAT_30 - -
- 1442287..1442348 + 62 NuclAT_30 - -
- 1442287..1442348 + 62 NuclAT_30 - -
- 1442287..1442348 + 62 NuclAT_30 - -
- 1442287..1442348 + 62 NuclAT_32 - -
- 1442287..1442348 + 62 NuclAT_32 - -
- 1442287..1442348 + 62 NuclAT_32 - -
- 1442287..1442348 + 62 NuclAT_32 - -
- 1442287..1442348 + 62 NuclAT_34 - -
- 1442287..1442348 + 62 NuclAT_34 - -
- 1442287..1442348 + 62 NuclAT_34 - -
- 1442287..1442348 + 62 NuclAT_34 - -
- 1442287..1442348 + 62 NuclAT_36 - -
- 1442287..1442348 + 62 NuclAT_36 - -
- 1442287..1442348 + 62 NuclAT_36 - -
- 1442287..1442348 + 62 NuclAT_36 - -
- 1442287..1442349 + 63 NuclAT_15 - -
- 1442287..1442349 + 63 NuclAT_15 - -
- 1442287..1442349 + 63 NuclAT_15 - -
- 1442287..1442349 + 63 NuclAT_15 - -
- 1442287..1442349 + 63 NuclAT_17 - -
- 1442287..1442349 + 63 NuclAT_17 - -
- 1442287..1442349 + 63 NuclAT_17 - -
- 1442287..1442349 + 63 NuclAT_17 - -
- 1442287..1442349 + 63 NuclAT_19 - -
- 1442287..1442349 + 63 NuclAT_19 - -
- 1442287..1442349 + 63 NuclAT_19 - -
- 1442287..1442349 + 63 NuclAT_19 - -
- 1442287..1442349 + 63 NuclAT_21 - -
- 1442287..1442349 + 63 NuclAT_21 - -
- 1442287..1442349 + 63 NuclAT_21 - -
- 1442287..1442349 + 63 NuclAT_21 - -
- 1442287..1442349 + 63 NuclAT_23 - -
- 1442287..1442349 + 63 NuclAT_23 - -
- 1442287..1442349 + 63 NuclAT_23 - -
- 1442287..1442349 + 63 NuclAT_23 - -
- 1442287..1442349 + 63 NuclAT_25 - -
- 1442287..1442349 + 63 NuclAT_25 - -
- 1442287..1442349 + 63 NuclAT_25 - -
- 1442287..1442349 + 63 NuclAT_25 - -
- 1442287..1442350 + 64 NuclAT_38 - -
- 1442287..1442350 + 64 NuclAT_38 - -
- 1442287..1442350 + 64 NuclAT_38 - -
- 1442287..1442350 + 64 NuclAT_38 - -
- 1442287..1442350 + 64 NuclAT_39 - -
- 1442287..1442350 + 64 NuclAT_39 - -
- 1442287..1442350 + 64 NuclAT_39 - -
- 1442287..1442350 + 64 NuclAT_39 - -
CP48_RS08790 1442640..1443740 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
CP48_RS08795 1444010..1444240 + 231 WP_001146442.1 putative cation transport regulator ChaB -
CP48_RS08800 1444398..1445093 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
CP48_RS08805 1445137..1445490 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T59116 WP_000170957.1 NZ_CP013662:c1441699-1441592 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGITTAAIVGWWRNRK

Download         Length: 108 bp

>T59116 NZ_CP013662:c1441699-1441592 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTACTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT59116 NZ_CP013662:1441747-1441813 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Y8S137

Antitoxin

Download structure file

References