Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 70016..70286 | Replicon | plasmid unnamed |
Accession | NZ_CP013657 | ||
Organism | Escherichia coli strain uk_P46212 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | AUO99_RS00425 | Protein ID | WP_001312861.1 |
Coordinates | 70128..70286 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 70016..70079 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AUO99_RS00395 | 65852..66337 | + | 486 | WP_042029316.1 | single-stranded DNA-binding protein | - |
AUO99_RS00400 | 66393..66626 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
AUO99_RS00405 | 66685..68643 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
AUO99_RS00410 | 68698..69132 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
AUO99_RS00415 | 69129..69848 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
AUO99_RS29570 | 69860..70048 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 69860..70084 | + | 225 | NuclAT_0 | - | - |
- | 69860..70084 | + | 225 | NuclAT_0 | - | - |
- | 69860..70084 | + | 225 | NuclAT_0 | - | - |
- | 69860..70084 | + | 225 | NuclAT_0 | - | - |
- | 70016..70079 | - | 64 | - | - | Antitoxin |
AUO99_RS00425 | 70128..70286 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
AUO99_RS00435 | 71205..71492 | + | 288 | WP_000107537.1 | hypothetical protein | - |
AUO99_RS00440 | 71612..72433 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
AUO99_RS00445 | 72730..73377 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
AUO99_RS00450 | 73663..74046 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
AUO99_RS00455 | 74240..74926 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
AUO99_RS00460 | 75020..75247 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / blaTEM-1B / tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 | - | 1..143748 | 143748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T59075 WP_001312861.1 NZ_CP013657:70128-70286 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T59075 NZ_CP013657:70128-70286 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT59075 NZ_CP013657:c70079-70016 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|