Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2573103..2573287 | Replicon | chromosome |
Accession | NZ_CP013621 | ||
Organism | Staphylococcus aureus strain RIVM3897 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | AUC50_RS13025 | Protein ID | WP_000482647.1 |
Coordinates | 2573180..2573287 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2573103..2573163 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AUC50_RS13000 | 2568557..2568724 | - | 168 | WP_001798790.1 | hypothetical protein | - |
AUC50_RS13010 | 2568955..2570688 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
AUC50_RS13015 | 2570713..2572476 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
- | 2573103..2573163 | + | 61 | - | - | Antitoxin |
AUC50_RS13025 | 2573180..2573287 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AUC50_RS13030 | 2573421..2573807 | - | 387 | WP_000779355.1 | flippase GtxA | - |
AUC50_RS13035 | 2574074..2575216 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
AUC50_RS13040 | 2575276..2575935 | + | 660 | WP_000831300.1 | hypothetical protein | - |
AUC50_RS13045 | 2576123..2577334 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
AUC50_RS13050 | 2577457..2577930 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T59050 WP_000482647.1 NZ_CP013621:c2573287-2573180 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T59050 NZ_CP013621:c2573287-2573180 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT59050 NZ_CP013621:2573103-2573163 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|