Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 2277302..2277500 | Replicon | chromosome |
| Accession | NZ_CP013621 | ||
| Organism | Staphylococcus aureus strain RIVM3897 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | AUC50_RS11460 | Protein ID | WP_001802298.1 |
| Coordinates | 2277396..2277500 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2277302..2277340 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUC50_RS11440 | 2273422..2274087 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
| AUC50_RS11445 | 2274239..2274559 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| AUC50_RS11450 | 2274561..2275541 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
| AUC50_RS11455 | 2275807..2276898 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
| - | 2277302..2277340 | + | 39 | - | - | Antitoxin |
| AUC50_RS11460 | 2277396..2277500 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| AUC50_RS15570 | 2278017..2278187 | + | 171 | WP_001807897.1 | hypothetical protein | - |
| AUC50_RS15180 | 2278180..2278338 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| AUC50_RS11465 | 2278774..2278866 | + | 93 | WP_000220902.1 | hypothetical protein | - |
| AUC50_RS11470 | 2278996..2279853 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
| AUC50_RS11475 | 2279921..2280703 | - | 783 | WP_060585346.1 | ABC transporter ATP-binding protein | - |
| AUC50_RS11480 | 2280993..2281601 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T59049 WP_001802298.1 NZ_CP013621:c2277500-2277396 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T59049 NZ_CP013621:c2277500-2277396 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT59049 NZ_CP013621:2277302-2277340 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|