Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 220780..220928 | Replicon | chromosome |
| Accession | NZ_CP013621 | ||
| Organism | Staphylococcus aureus strain RIVM3897 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | AUC50_RS15365 | Protein ID | WP_011276848.1 |
| Coordinates | 220780..220875 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 220893..220928 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUC50_RS14635 | 217149..217343 | + | 195 | WP_021459082.1 | hypothetical protein | - |
| AUC50_RS00960 | 217340..218014 | - | 675 | WP_002512555.1 | IS6 family transposase | - |
| AUC50_RS15550 | 218156..218308 | + | 153 | WP_158501055.1 | hypothetical protein | - |
| AUC50_RS15590 | 218382..218549 | - | 168 | WP_162837505.1 | hypothetical protein | - |
| AUC50_RS00965 | 218580..218810 | - | 231 | WP_031884148.1 | SHOCT domain-containing protein | - |
| AUC50_RS15670 | 218944..219036 | - | 93 | WP_002499091.1 | hypothetical protein | - |
| AUC50_RS00980 | 219631..220248 | + | 618 | WP_002467537.1 | CadD family cadmium resistance transporter | - |
| AUC50_RS00985 | 220267..220614 | + | 348 | WP_002467551.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| AUC50_RS15365 | 220780..220875 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 220893..220928 | + | 36 | - | - | Antitoxin |
| AUC50_RS00990 | 221230..221703 | + | 474 | WP_077460978.1 | thymidylate synthase | - |
| AUC50_RS00995 | 221817..222245 | + | 429 | WP_031885498.1 | Rrf2 family transcriptional regulator | - |
| AUC50_RS14640 | 222366..222941 | + | 576 | Protein_197 | DsbA family protein | - |
| AUC50_RS01005 | 222958..223608 | + | 651 | WP_031885497.1 | NAD(P)-dependent oxidoreductase | - |
| AUC50_RS01010 | 223907..224662 | - | 756 | WP_031863945.1 | sulfite exporter TauE/SafE family protein | - |
| AUC50_RS01015 | 224662..224922 | - | 261 | WP_031863946.1 | persulfide-sensing transcriptional repressor CstR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 217340..218014 | 674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T59038 WP_011276848.1 NZ_CP013621:220780-220875 [Staphylococcus aureus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T59038 NZ_CP013621:220780-220875 [Staphylococcus aureus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT59038 NZ_CP013621:220893-220928 [Staphylococcus aureus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|