Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2164438..2164636 | Replicon | chromosome |
Accession | NZ_CP013619 | ||
Organism | Staphylococcus aureus strain RIVM1607 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AUC49_RS10695 | Protein ID | WP_001802298.1 |
Coordinates | 2164532..2164636 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2164438..2164476 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AUC49_RS10675 | 2160558..2161223 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
AUC49_RS10680 | 2161375..2161695 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AUC49_RS10685 | 2161697..2162677 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
AUC49_RS10690 | 2162943..2164034 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2164438..2164476 | + | 39 | - | - | Antitoxin |
AUC49_RS10695 | 2164532..2164636 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AUC49_RS14295 | 2165316..2165474 | + | 159 | WP_001792784.1 | hypothetical protein | - |
AUC49_RS14300 | 2165910..2166002 | + | 93 | WP_000220902.1 | hypothetical protein | - |
AUC49_RS10700 | 2166132..2166989 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
AUC49_RS10705 | 2167057..2167839 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
AUC49_RS10710 | 2168129..2168737 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T59035 WP_001802298.1 NZ_CP013619:c2164636-2164532 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T59035 NZ_CP013619:c2164636-2164532 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT59035 NZ_CP013619:2164438-2164476 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|