Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2468557..2468741 | Replicon | chromosome |
Accession | NZ_CP013616 | ||
Organism | Staphylococcus aureus strain RIVM1295 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | AUC48_RS12410 | Protein ID | WP_000482647.1 |
Coordinates | 2468634..2468741 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2468557..2468617 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AUC48_RS12385 | 2464011..2464178 | - | 168 | WP_001798790.1 | hypothetical protein | - |
AUC48_RS12395 | 2464409..2466142 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
AUC48_RS12400 | 2466167..2467930 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
- | 2468557..2468617 | + | 61 | - | - | Antitoxin |
AUC48_RS12410 | 2468634..2468741 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AUC48_RS12415 | 2468875..2469261 | - | 387 | WP_000779355.1 | flippase GtxA | - |
AUC48_RS12420 | 2469528..2470670 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
AUC48_RS12425 | 2470730..2471389 | + | 660 | WP_000831300.1 | hypothetical protein | - |
AUC48_RS12430 | 2471577..2472788 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
AUC48_RS12435 | 2472911..2473384 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T59027 WP_000482647.1 NZ_CP013616:c2468741-2468634 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T59027 NZ_CP013616:c2468741-2468634 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT59027 NZ_CP013616:2468557-2468617 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|