Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1586339..1586523 | Replicon | chromosome |
Accession | NZ_CP013231 | ||
Organism | Staphylococcus aureus strain UTSW MRSA 55 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | AS858_RS09135 | Protein ID | WP_000482650.1 |
Coordinates | 1586416..1586523 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1586339..1586399 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AS858_RS09110 | 1581869..1582036 | - | 168 | WP_001790576.1 | hypothetical protein | - |
AS858_RS09120 | 1582267..1584000 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
AS858_RS09125 | 1584025..1585788 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 1586339..1586399 | + | 61 | - | - | Antitoxin |
AS858_RS09135 | 1586416..1586523 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AS858_RS09140 | 1586657..1587043 | - | 387 | WP_000779358.1 | flippase GtxA | - |
AS858_RS09145 | 1587311..1588453 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
AS858_RS09150 | 1588513..1589172 | + | 660 | WP_000831298.1 | membrane protein | - |
AS858_RS09155 | 1589354..1590565 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
AS858_RS09160 | 1590688..1591161 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T58147 WP_000482650.1 NZ_CP013231:c1586523-1586416 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T58147 NZ_CP013231:c1586523-1586416 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT58147 NZ_CP013231:1586339-1586399 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|