Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1120060..1120359 | Replicon | chromosome |
Accession | NZ_CP013231 | ||
Organism | Staphylococcus aureus strain UTSW MRSA 55 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | AS858_RS16050 | Protein ID | WP_011447039.1 |
Coordinates | 1120183..1120359 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1120060..1120115 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AS858_RS06520 | 1115391..1115651 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AS858_RS06525 | 1115704..1116054 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AS858_RS06530 | 1116739..1117188 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
AS858_RS16815 | 1117283..1117618 | - | 336 | Protein_1080 | SH3 domain-containing protein | - |
AS858_RS06540 | 1118268..1118759 | - | 492 | WP_000919350.1 | staphylokinase | - |
AS858_RS06545 | 1118950..1119705 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AS858_RS06550 | 1119717..1119971 | - | 255 | WP_000611512.1 | phage holin | - |
AS858_RS06555 | 1120023..1120130 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1120052..1120191 | + | 140 | NuclAT_0 | - | - |
- | 1120052..1120191 | + | 140 | NuclAT_0 | - | - |
- | 1120052..1120191 | + | 140 | NuclAT_0 | - | - |
- | 1120052..1120191 | + | 140 | NuclAT_0 | - | - |
- | 1120060..1120115 | + | 56 | - | - | Antitoxin |
AS858_RS16050 | 1120183..1120359 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
AS858_RS06560 | 1120509..1120805 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
AS858_RS06565 | 1120863..1121150 | - | 288 | WP_001040261.1 | hypothetical protein | - |
AS858_RS06570 | 1121197..1121349 | - | 153 | WP_001153681.1 | hypothetical protein | - |
AS858_RS06575 | 1121339..1125124 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1115704..1174671 | 58967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T58138 WP_011447039.1 NZ_CP013231:c1120359-1120183 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T58138 NZ_CP013231:c1120359-1120183 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT58138 NZ_CP013231:1120060-1120115 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|