Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 959071..959253 | Replicon | chromosome |
| Accession | NZ_CP013231 | ||
| Organism | Staphylococcus aureus strain UTSW MRSA 55 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AS858_RS16770 | Protein ID | WP_001801861.1 |
| Coordinates | 959071..959166 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 959194..959253 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AS858_RS05530 | 954731..955357 | + | 627 | Protein_918 | hypothetical protein | - |
| AS858_RS05535 | 955398..955742 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| AS858_RS05540 | 955840..956391 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| AS858_RS05545 | 956609..957250 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AS858_RS05550 | 957364..957549 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| AS858_RS05555 | 957551..957727 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| AS858_RS05560 | 957738..958121 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| AS858_RS05570 | 958725..958868 | - | 144 | WP_001549059.1 | transposase | - |
| AS858_RS16770 | 959071..959166 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 959194..959253 | - | 60 | - | - | Antitoxin |
| AS858_RS05575 | 959289..959390 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| AS858_RS15975 | 959368..959544 | - | 177 | Protein_928 | transposase | - |
| AS858_RS05580 | 959738..960115 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 952171..977773 | 25602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T58135 WP_001801861.1 NZ_CP013231:959071-959166 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T58135 NZ_CP013231:959071-959166 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT58135 NZ_CP013231:c959253-959194 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|