Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2227248..2227446 | Replicon | chromosome |
Accession | NZ_CP013218 | ||
Organism | Staphylococcus aureus strain LA-MRSA ST398 isolate E154 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | AS852_RS11575 | Protein ID | WP_001802298.1 |
Coordinates | 2227342..2227446 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2227248..2227286 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AS852_RS11555 | 2223368..2224033 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
AS852_RS11560 | 2224185..2224505 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
AS852_RS11565 | 2224507..2225487 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
AS852_RS11570 | 2225753..2226844 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2227248..2227286 | + | 39 | - | - | Antitoxin |
AS852_RS11575 | 2227342..2227446 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
AS852_RS15305 | 2227963..2228133 | + | 171 | WP_001807897.1 | hypothetical protein | - |
AS852_RS11590 | 2228126..2228284 | + | 159 | WP_001792784.1 | hypothetical protein | - |
AS852_RS11595 | 2228720..2228812 | + | 93 | WP_000220902.1 | hypothetical protein | - |
AS852_RS11600 | 2228942..2229799 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
AS852_RS11605 | 2229867..2230649 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
AS852_RS11610 | 2230939..2231547 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T58129 WP_001802298.1 NZ_CP013218:c2227446-2227342 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T58129 NZ_CP013218:c2227446-2227342 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT58129 NZ_CP013218:2227248-2227286 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|