Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1989005..1989189 | Replicon | chromosome |
Accession | NZ_CP013137 | ||
Organism | Staphylococcus aureus strain XQ |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | ASU36_RS10400 | Protein ID | WP_000482647.1 |
Coordinates | 1989082..1989189 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1989005..1989065 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASU36_RS10375 | 1984459..1984626 | - | 168 | WP_031927726.1 | hypothetical protein | - |
ASU36_RS10385 | 1984857..1986590 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
ASU36_RS10390 | 1986615..1988378 | - | 1764 | WP_031927727.1 | ABC transporter ATP-binding protein/permease | - |
- | 1989005..1989065 | + | 61 | - | - | Antitoxin |
ASU36_RS10400 | 1989082..1989189 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
ASU36_RS10405 | 1989323..1989709 | - | 387 | WP_000779353.1 | flippase GtxA | - |
ASU36_RS10410 | 1989977..1991119 | + | 1143 | WP_031927728.1 | glycerate kinase | - |
ASU36_RS10415 | 1991179..1991838 | + | 660 | WP_031927729.1 | membrane protein | - |
ASU36_RS10420 | 1992020..1993231 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
ASU36_RS10425 | 1993354..1993827 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T58006 WP_000482647.1 NZ_CP013137:c1989189-1989082 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T58006 NZ_CP013137:c1989189-1989082 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT58006 NZ_CP013137:1989005-1989065 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|