Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1837544..1837732 | Replicon | chromosome |
Accession | NZ_CP013132 | ||
Organism | Staphylococcus aureus strain FORC_026 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | Q8VVS0 |
Locus tag | FORC26_RS14400 | Protein ID | WP_001791613.1 |
Coordinates | 1837544..1837636 (+) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1837673..1837732 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC26_RS09235 | 1833213..1833839 | + | 627 | WP_000669017.1 | hypothetical protein | - |
FORC26_RS09240 | 1833880..1834221 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
FORC26_RS09245 | 1834322..1834894 | + | 573 | WP_000414202.1 | hypothetical protein | - |
FORC26_RS09250 | 1835092..1835649 | - | 558 | Protein_1705 | ImmA/IrrE family metallo-endopeptidase | - |
FORC26_RS09260 | 1836023..1836199 | - | 177 | WP_000375477.1 | hypothetical protein | - |
FORC26_RS09265 | 1836210..1836593 | - | 384 | WP_000070814.1 | hypothetical protein | - |
FORC26_RS09275 | 1837197..1837340 | - | 144 | WP_001549059.1 | transposase | - |
FORC26_RS14400 | 1837544..1837636 | + | 93 | WP_001791613.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1837673..1837732 | - | 60 | - | - | Antitoxin |
FORC26_RS09280 | 1837768..1837869 | + | 102 | WP_001791893.1 | hypothetical protein | - |
FORC26_RS09285 | 1837847..1838023 | - | 177 | Protein_1711 | transposase | - |
FORC26_RS09290 | 1838217..1838594 | - | 378 | Protein_1712 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1831449..1890562 | 59113 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3471.23 Da Isoelectric Point: 9.7333
>T57974 WP_001791613.1 NZ_CP013132:1837544-1837636 [Staphylococcus aureus]
MLIIFVHIIAPVISGCAVAYYTYWLSKRNK
MLIIFVHIIAPVISGCAVAYYTYWLSKRNK
Download Length: 93 bp
>T57974 NZ_CP013132:1837544-1837636 [Staphylococcus aureus]
TTGCTAATCATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCTGTTGCGTATTATACTTATTGGCTTAGTAA
ACGCAACAAATAA
TTGCTAATCATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCTGTTGCGTATTATACTTATTGGCTTAGTAA
ACGCAACAAATAA
Antitoxin
Download Length: 60 bp
>AT57974 NZ_CP013132:c1837732-1837673 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGTGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGTGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|