Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2024950..2025170 | Replicon | chromosome |
| Accession | NZ_CP013031 | ||
| Organism | Escherichia coli strain H1827/12 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E3PKK3 |
| Locus tag | AB847_RS10025 | Protein ID | WP_000170951.1 |
| Coordinates | 2024950..2025057 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2025107..2025170 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB847_RS09990 | 2020084..2021166 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| AB847_RS09995 | 2021166..2021999 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| AB847_RS10000 | 2021996..2022388 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
| AB847_RS10005 | 2022392..2023201 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| AB847_RS10010 | 2023237..2024091 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| AB847_RS10020 | 2024285..2024743 | + | 459 | WP_000526135.1 | IS200/IS605 family transposase | - |
| AB847_RS10025 | 2024950..2025057 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2025107..2025170 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_45 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_45 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_45 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_45 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_48 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_48 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_48 | - | Antitoxin |
| - | 2025107..2025170 | + | 64 | NuclAT_48 | - | Antitoxin |
| AB847_RS10030 | 2025485..2025592 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
| - | 2025640..2025705 | + | 66 | NuclAT_29 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_29 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_29 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_29 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_32 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_32 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_32 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_32 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_35 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_35 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_35 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_35 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_38 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_38 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_38 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_38 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_43 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_43 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_43 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_43 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_46 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_46 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_46 | - | - |
| - | 2025640..2025705 | + | 66 | NuclAT_46 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_16 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_16 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_16 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_16 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_18 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_18 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_18 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_18 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_20 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_20 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_20 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_20 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_22 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_22 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_22 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_22 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_24 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_24 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_24 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_24 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_26 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_26 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_26 | - | - |
| - | 2025640..2025707 | + | 68 | NuclAT_26 | - | - |
| AB847_RS10035 | 2026020..2026127 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2026175..2026240 | + | 66 | NuclAT_30 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_30 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_30 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_30 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_33 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_33 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_33 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_33 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_36 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_36 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_36 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_36 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_39 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_39 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_39 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_39 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_44 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_44 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_44 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_44 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_47 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_47 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_47 | - | - |
| - | 2026175..2026240 | + | 66 | NuclAT_47 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_15 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_15 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_15 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_15 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_17 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_17 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_17 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_17 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_19 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_19 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_19 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_19 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_21 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_21 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_21 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_21 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_23 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_23 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_23 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_23 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_25 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_25 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_25 | - | - |
| - | 2026175..2026242 | + | 68 | NuclAT_25 | - | - |
| AB847_RS10040 | 2026532..2027632 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| AB847_RS10045 | 2027902..2028132 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| AB847_RS10050 | 2028290..2028985 | + | 696 | WP_012775986.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| AB847_RS10055 | 2029029..2029382 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2024285..2024743 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T57796 WP_000170951.1 NZ_CP013031:c2025057-2024950 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T57796 NZ_CP013031:c2025057-2024950 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT57796 NZ_CP013031:2025107-2025170 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|