Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2024950..2025170 Replicon chromosome
Accession NZ_CP013031
Organism Escherichia coli strain H1827/12

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag AB847_RS10025 Protein ID WP_000170951.1
Coordinates 2024950..2025057 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2025107..2025170 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AB847_RS09990 2020084..2021166 + 1083 WP_000804726.1 peptide chain release factor 1 -
AB847_RS09995 2021166..2021999 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
AB847_RS10000 2021996..2022388 + 393 WP_000200373.1 invasion regulator SirB2 -
AB847_RS10005 2022392..2023201 + 810 WP_001257044.1 invasion regulator SirB1 -
AB847_RS10010 2023237..2024091 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AB847_RS10020 2024285..2024743 + 459 WP_000526135.1 IS200/IS605 family transposase -
AB847_RS10025 2024950..2025057 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2025107..2025170 + 64 NuclAT_31 - Antitoxin
- 2025107..2025170 + 64 NuclAT_31 - Antitoxin
- 2025107..2025170 + 64 NuclAT_31 - Antitoxin
- 2025107..2025170 + 64 NuclAT_31 - Antitoxin
- 2025107..2025170 + 64 NuclAT_34 - Antitoxin
- 2025107..2025170 + 64 NuclAT_34 - Antitoxin
- 2025107..2025170 + 64 NuclAT_34 - Antitoxin
- 2025107..2025170 + 64 NuclAT_34 - Antitoxin
- 2025107..2025170 + 64 NuclAT_37 - Antitoxin
- 2025107..2025170 + 64 NuclAT_37 - Antitoxin
- 2025107..2025170 + 64 NuclAT_37 - Antitoxin
- 2025107..2025170 + 64 NuclAT_37 - Antitoxin
- 2025107..2025170 + 64 NuclAT_40 - Antitoxin
- 2025107..2025170 + 64 NuclAT_40 - Antitoxin
- 2025107..2025170 + 64 NuclAT_40 - Antitoxin
- 2025107..2025170 + 64 NuclAT_40 - Antitoxin
- 2025107..2025170 + 64 NuclAT_45 - Antitoxin
- 2025107..2025170 + 64 NuclAT_45 - Antitoxin
- 2025107..2025170 + 64 NuclAT_45 - Antitoxin
- 2025107..2025170 + 64 NuclAT_45 - Antitoxin
- 2025107..2025170 + 64 NuclAT_48 - Antitoxin
- 2025107..2025170 + 64 NuclAT_48 - Antitoxin
- 2025107..2025170 + 64 NuclAT_48 - Antitoxin
- 2025107..2025170 + 64 NuclAT_48 - Antitoxin
AB847_RS10030 2025485..2025592 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 2025640..2025705 + 66 NuclAT_29 - -
- 2025640..2025705 + 66 NuclAT_29 - -
- 2025640..2025705 + 66 NuclAT_29 - -
- 2025640..2025705 + 66 NuclAT_29 - -
- 2025640..2025705 + 66 NuclAT_32 - -
- 2025640..2025705 + 66 NuclAT_32 - -
- 2025640..2025705 + 66 NuclAT_32 - -
- 2025640..2025705 + 66 NuclAT_32 - -
- 2025640..2025705 + 66 NuclAT_35 - -
- 2025640..2025705 + 66 NuclAT_35 - -
- 2025640..2025705 + 66 NuclAT_35 - -
- 2025640..2025705 + 66 NuclAT_35 - -
- 2025640..2025705 + 66 NuclAT_38 - -
- 2025640..2025705 + 66 NuclAT_38 - -
- 2025640..2025705 + 66 NuclAT_38 - -
- 2025640..2025705 + 66 NuclAT_38 - -
- 2025640..2025705 + 66 NuclAT_43 - -
- 2025640..2025705 + 66 NuclAT_43 - -
- 2025640..2025705 + 66 NuclAT_43 - -
- 2025640..2025705 + 66 NuclAT_43 - -
- 2025640..2025705 + 66 NuclAT_46 - -
- 2025640..2025705 + 66 NuclAT_46 - -
- 2025640..2025705 + 66 NuclAT_46 - -
- 2025640..2025705 + 66 NuclAT_46 - -
- 2025640..2025707 + 68 NuclAT_16 - -
- 2025640..2025707 + 68 NuclAT_16 - -
- 2025640..2025707 + 68 NuclAT_16 - -
- 2025640..2025707 + 68 NuclAT_16 - -
- 2025640..2025707 + 68 NuclAT_18 - -
- 2025640..2025707 + 68 NuclAT_18 - -
- 2025640..2025707 + 68 NuclAT_18 - -
- 2025640..2025707 + 68 NuclAT_18 - -
- 2025640..2025707 + 68 NuclAT_20 - -
- 2025640..2025707 + 68 NuclAT_20 - -
- 2025640..2025707 + 68 NuclAT_20 - -
- 2025640..2025707 + 68 NuclAT_20 - -
- 2025640..2025707 + 68 NuclAT_22 - -
- 2025640..2025707 + 68 NuclAT_22 - -
- 2025640..2025707 + 68 NuclAT_22 - -
- 2025640..2025707 + 68 NuclAT_22 - -
- 2025640..2025707 + 68 NuclAT_24 - -
- 2025640..2025707 + 68 NuclAT_24 - -
- 2025640..2025707 + 68 NuclAT_24 - -
- 2025640..2025707 + 68 NuclAT_24 - -
- 2025640..2025707 + 68 NuclAT_26 - -
- 2025640..2025707 + 68 NuclAT_26 - -
- 2025640..2025707 + 68 NuclAT_26 - -
- 2025640..2025707 + 68 NuclAT_26 - -
AB847_RS10035 2026020..2026127 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2026175..2026240 + 66 NuclAT_30 - -
- 2026175..2026240 + 66 NuclAT_30 - -
- 2026175..2026240 + 66 NuclAT_30 - -
- 2026175..2026240 + 66 NuclAT_30 - -
- 2026175..2026240 + 66 NuclAT_33 - -
- 2026175..2026240 + 66 NuclAT_33 - -
- 2026175..2026240 + 66 NuclAT_33 - -
- 2026175..2026240 + 66 NuclAT_33 - -
- 2026175..2026240 + 66 NuclAT_36 - -
- 2026175..2026240 + 66 NuclAT_36 - -
- 2026175..2026240 + 66 NuclAT_36 - -
- 2026175..2026240 + 66 NuclAT_36 - -
- 2026175..2026240 + 66 NuclAT_39 - -
- 2026175..2026240 + 66 NuclAT_39 - -
- 2026175..2026240 + 66 NuclAT_39 - -
- 2026175..2026240 + 66 NuclAT_39 - -
- 2026175..2026240 + 66 NuclAT_44 - -
- 2026175..2026240 + 66 NuclAT_44 - -
- 2026175..2026240 + 66 NuclAT_44 - -
- 2026175..2026240 + 66 NuclAT_44 - -
- 2026175..2026240 + 66 NuclAT_47 - -
- 2026175..2026240 + 66 NuclAT_47 - -
- 2026175..2026240 + 66 NuclAT_47 - -
- 2026175..2026240 + 66 NuclAT_47 - -
- 2026175..2026242 + 68 NuclAT_15 - -
- 2026175..2026242 + 68 NuclAT_15 - -
- 2026175..2026242 + 68 NuclAT_15 - -
- 2026175..2026242 + 68 NuclAT_15 - -
- 2026175..2026242 + 68 NuclAT_17 - -
- 2026175..2026242 + 68 NuclAT_17 - -
- 2026175..2026242 + 68 NuclAT_17 - -
- 2026175..2026242 + 68 NuclAT_17 - -
- 2026175..2026242 + 68 NuclAT_19 - -
- 2026175..2026242 + 68 NuclAT_19 - -
- 2026175..2026242 + 68 NuclAT_19 - -
- 2026175..2026242 + 68 NuclAT_19 - -
- 2026175..2026242 + 68 NuclAT_21 - -
- 2026175..2026242 + 68 NuclAT_21 - -
- 2026175..2026242 + 68 NuclAT_21 - -
- 2026175..2026242 + 68 NuclAT_21 - -
- 2026175..2026242 + 68 NuclAT_23 - -
- 2026175..2026242 + 68 NuclAT_23 - -
- 2026175..2026242 + 68 NuclAT_23 - -
- 2026175..2026242 + 68 NuclAT_23 - -
- 2026175..2026242 + 68 NuclAT_25 - -
- 2026175..2026242 + 68 NuclAT_25 - -
- 2026175..2026242 + 68 NuclAT_25 - -
- 2026175..2026242 + 68 NuclAT_25 - -
AB847_RS10040 2026532..2027632 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
AB847_RS10045 2027902..2028132 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AB847_RS10050 2028290..2028985 + 696 WP_012775986.1 glutathione-specific gamma-glutamylcyclotransferase -
AB847_RS10055 2029029..2029382 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2024285..2024743 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T57796 WP_000170951.1 NZ_CP013031:c2025057-2024950 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T57796 NZ_CP013031:c2025057-2024950 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT57796 NZ_CP013031:2025107-2025170 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References