Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2490323..2490545 | Replicon | chromosome |
| Accession | NZ_CP013025 | ||
| Organism | Escherichia coli strain 2009C-3133 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | MJ49_RS31750 | Protein ID | WP_000170738.1 |
| Coordinates | 2490438..2490545 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2490323..2490389 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MJ49_RS13240 | 2485764..2486666 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| MJ49_RS13245 | 2486677..2487660 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| MJ49_RS13250 | 2487657..2488661 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| MJ49_RS13255 | 2488691..2489962 | - | 1272 | WP_001318103.1 | amino acid permease | - |
| - | 2490323..2490389 | - | 67 | - | - | Antitoxin |
| MJ49_RS31750 | 2490438..2490545 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| MJ49_RS29060 | 2490921..2491028 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MJ49_RS32750 | 2491404..2491511 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MJ49_RS32270 | 2491887..2491994 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MJ49_RS13285 | 2492219..2492677 | + | 459 | WP_000526135.1 | IS200/IS605 family transposase | - |
| MJ49_RS13290 | 2492792..2494471 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| MJ49_RS13295 | 2494468..2494659 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2492219..2492677 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T57728 WP_000170738.1 NZ_CP013025:2490438-2490545 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T57728 NZ_CP013025:2490438-2490545 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT57728 NZ_CP013025:c2490389-2490323 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|