Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2368743..2368927 | Replicon | chromosome |
Accession | NZ_CP012979 | ||
Organism | Staphylococcus aureus strain ST20130940 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAST40_RS11865 | Protein ID | WP_000482647.1 |
Coordinates | 2368820..2368927 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2368743..2368803 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST40_RS11840 | 2364197..2364364 | - | 168 | WP_001792506.1 | hypothetical protein | - |
SAST40_RS11850 | 2364595..2366328 | - | 1734 | WP_000486496.1 | ABC transporter ATP-binding protein/permease | - |
SAST40_RS11855 | 2366353..2368116 | - | 1764 | WP_001064836.1 | ABC transporter ATP-binding protein/permease | - |
- | 2368743..2368803 | + | 61 | - | - | Antitoxin |
SAST40_RS11865 | 2368820..2368927 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAST40_RS11870 | 2369061..2369447 | - | 387 | WP_000779360.1 | flippase GtxA | - |
SAST40_RS11875 | 2369705..2370847 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAST40_RS11880 | 2370907..2371566 | + | 660 | WP_000831295.1 | hypothetical protein | - |
SAST40_RS11885 | 2371748..2372959 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAST40_RS11890 | 2373082..2373555 | - | 474 | WP_062909965.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T57590 WP_000482647.1 NZ_CP012979:c2368927-2368820 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T57590 NZ_CP012979:c2368927-2368820 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT57590 NZ_CP012979:2368743-2368803 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|