Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2087738..2087935 | Replicon | chromosome |
Accession | NZ_CP012978 | ||
Organism | Staphylococcus aureus strain ST20130941 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAST41_RS10375 | Protein ID | WP_001802298.1 |
Coordinates | 2087831..2087935 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2087738..2087776 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST41_RS10360 | 2083011..2083991 | + | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
SAST41_RS10365 | 2084257..2085348 | + | 1092 | WP_000495672.1 | hypothetical protein | - |
SAST41_RS10370 | 2085377..2087023 | - | 1647 | WP_000277718.1 | IS1182 family transposase | - |
- | 2087738..2087776 | + | 39 | - | - | Antitoxin |
SAST41_RS10375 | 2087831..2087935 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAST41_RS13845 | 2088615..2088773 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAST41_RS10380 | 2089432..2090289 | - | 858 | WP_000370931.1 | Cof-type HAD-IIB family hydrolase | - |
SAST41_RS10385 | 2090357..2091139 | - | 783 | WP_000908174.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2085377..2087023 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T57578 WP_001802298.1 NZ_CP012978:c2087935-2087831 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T57578 NZ_CP012978:c2087935-2087831 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT57578 NZ_CP012978:2087738-2087776 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|