Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2423927..2424111 | Replicon | chromosome |
Accession | NZ_CP012976 | ||
Organism | Staphylococcus aureus strain ST20130942 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | SAST42_RS12285 | Protein ID | WP_000482652.1 |
Coordinates | 2424004..2424111 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2423927..2423987 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST42_RS12260 | 2419438..2419605 | - | 168 | Protein_2323 | hypothetical protein | - |
SAST42_RS12270 | 2419836..2421569 | - | 1734 | WP_031918671.1 | ABC transporter ATP-binding protein/permease | - |
SAST42_RS12275 | 2421594..2423357 | - | 1764 | WP_001064809.1 | ABC transporter ATP-binding protein/permease | - |
- | 2423927..2423987 | + | 61 | - | - | Antitoxin |
SAST42_RS12285 | 2424004..2424111 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAST42_RS12290 | 2424245..2424631 | - | 387 | WP_000779357.1 | flippase GtxA | - |
SAST42_RS12295 | 2424899..2426041 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAST42_RS12300 | 2426101..2426760 | + | 660 | WP_000831298.1 | membrane protein | - |
SAST42_RS12305 | 2426942..2428153 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAST42_RS12310 | 2428276..2428749 | - | 474 | WP_000456484.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T57570 WP_000482652.1 NZ_CP012976:c2424111-2424004 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T57570 NZ_CP012976:c2424111-2424004 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT57570 NZ_CP012976:2423927-2423987 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|