Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2137299..2137515 | Replicon | chromosome |
Accession | NZ_CP012976 | ||
Organism | Staphylococcus aureus strain ST20130942 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAST42_RS10780 | Protein ID | WP_001802298.1 |
Coordinates | 2137411..2137515 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2137299..2137354 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST42_RS10760 | 2133493..2134158 | - | 666 | WP_001024093.1 | SDR family oxidoreductase | - |
SAST42_RS10765 | 2134310..2134630 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAST42_RS10770 | 2134632..2135612 | + | 981 | WP_000019745.1 | CDF family zinc efflux transporter CzrB | - |
SAST42_RS10775 | 2135878..2136969 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2137299..2137354 | + | 56 | - | - | Antitoxin |
SAST42_RS10780 | 2137411..2137515 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAST42_RS14420 | 2138195..2138353 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAST42_RS10785 | 2139011..2139868 | - | 858 | WP_000370926.1 | Cof-type HAD-IIB family hydrolase | - |
SAST42_RS10790 | 2139936..2140718 | - | 783 | WP_000908175.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T57567 WP_001802298.1 NZ_CP012976:c2137515-2137411 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T57567 NZ_CP012976:c2137515-2137411 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT57567 NZ_CP012976:2137299-2137354 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|