Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1802681..1802861 | Replicon | chromosome |
Accession | NZ_CP012976 | ||
Organism | Staphylococcus aureus strain ST20130942 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAST42_RS14675 | Protein ID | WP_001801861.1 |
Coordinates | 1802681..1802776 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1802804..1802861 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST42_RS08730 | 1797843..1798493 | + | 651 | WP_072470537.1 | excalibur calcium-binding domain-containing protein | - |
SAST42_RS08735 | 1798574..1799569 | + | 996 | WP_000070641.1 | DUF4352 domain-containing protein | - |
SAST42_RS08740 | 1799644..1800270 | + | 627 | WP_000669026.1 | hypothetical protein | - |
SAST42_RS08745 | 1800311..1800652 | + | 342 | WP_000627537.1 | DUF3969 family protein | - |
SAST42_RS08750 | 1800753..1801325 | + | 573 | WP_000414215.1 | hypothetical protein | - |
SAST42_RS14325 | 1801524..1802536 | - | 1013 | Protein_1678 | IS3 family transposase | - |
SAST42_RS14675 | 1802681..1802776 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1802804..1802861 | - | 58 | - | - | Antitoxin |
SAST42_RS08770 | 1802899..1803000 | + | 102 | WP_001792025.1 | hypothetical protein | - |
SAST42_RS14680 | 1802978..1803139 | - | 162 | Protein_1681 | transposase | - |
SAST42_RS08775 | 1803130..1803624 | - | 495 | Protein_1682 | transposase | - |
SAST42_RS08780 | 1804076..1805305 | - | 1230 | WP_047230715.1 | restriction endonuclease subunit S | - |
SAST42_RS08785 | 1805298..1806853 | - | 1556 | Protein_1684 | type I restriction-modification system subunit M | - |
SAST42_RS08790 | 1807018..1807152 | - | 135 | Protein_1685 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T57559 WP_001801861.1 NZ_CP012976:1802681-1802776 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T57559 NZ_CP012976:1802681-1802776 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT57559 NZ_CP012976:c1802861-1802804 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|