Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2415802..2415985 | Replicon | chromosome |
Accession | NZ_CP012972 | ||
Organism | Staphylococcus aureus strain ST20130938 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAST38_RS12215 | Protein ID | WP_000482647.1 |
Coordinates | 2415878..2415985 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2415802..2415861 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST38_RS12190 | 2411256..2411423 | - | 168 | WP_001792506.1 | hypothetical protein | - |
SAST38_RS12200 | 2411654..2413387 | - | 1734 | WP_000486496.1 | ABC transporter ATP-binding protein/permease | - |
SAST38_RS12205 | 2413412..2415175 | - | 1764 | WP_001064836.1 | ABC transporter ATP-binding protein/permease | - |
- | 2415802..2415861 | + | 60 | - | - | Antitoxin |
SAST38_RS12215 | 2415878..2415985 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAST38_RS12220 | 2416119..2416505 | - | 387 | WP_000779360.1 | flippase GtxA | - |
SAST38_RS12225 | 2416763..2417905 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAST38_RS12230 | 2417965..2418624 | + | 660 | WP_000831295.1 | hypothetical protein | - |
SAST38_RS12235 | 2418806..2420017 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAST38_RS12240 | 2420140..2420613 | - | 474 | WP_000456492.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T57540 WP_000482647.1 NZ_CP012972:c2415985-2415878 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T57540 NZ_CP012972:c2415985-2415878 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 60 bp
>AT57540 NZ_CP012972:2415802-2415861 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGG
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|