Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2416141..2416324 | Replicon | chromosome |
Accession | NZ_CP012970 | ||
Organism | Staphylococcus aureus strain ST20130939 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAST39_RS12215 | Protein ID | WP_000482647.1 |
Coordinates | 2416217..2416324 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2416141..2416200 (+) |
Genomic Context
Location: 2416141..2416200 (60 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2417102..2418244 (1143 bp)
Type: Others
Protein ID: WP_001176863.1
Type: Others
Protein ID: WP_001176863.1
Location: 2418304..2418963 (660 bp)
Type: Others
Protein ID: WP_000831295.1
Type: Others
Protein ID: WP_000831295.1
Location: 2419145..2420356 (1212 bp)
Type: Others
Protein ID: WP_001192075.1
Type: Others
Protein ID: WP_001192075.1
Location: 2411595..2411762 (168 bp)
Type: Others
Protein ID: WP_001792506.1
Type: Others
Protein ID: WP_001792506.1
Location: 2411993..2413726 (1734 bp)
Type: Others
Protein ID: WP_000486496.1
Type: Others
Protein ID: WP_000486496.1
Location: 2413751..2415514 (1764 bp)
Type: Others
Protein ID: WP_001064836.1
Type: Others
Protein ID: WP_001064836.1
Location: 2416217..2416324 (108 bp)
Type: Toxin
Protein ID: WP_000482647.1
Type: Toxin
Protein ID: WP_000482647.1
Location: 2416458..2416844 (387 bp)
Type: Others
Protein ID: WP_000779360.1
Type: Others
Protein ID: WP_000779360.1
Location: 2420479..2420952 (474 bp)
Type: Others
Protein ID: WP_000456492.1
Type: Others
Protein ID: WP_000456492.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST39_RS12190 | 2411595..2411762 | - | 168 | WP_001792506.1 | hypothetical protein | - |
SAST39_RS12200 | 2411993..2413726 | - | 1734 | WP_000486496.1 | ABC transporter ATP-binding protein/permease | - |
SAST39_RS12205 | 2413751..2415514 | - | 1764 | WP_001064836.1 | ABC transporter ATP-binding protein/permease | - |
- | 2416141..2416200 | + | 60 | - | - | Antitoxin |
SAST39_RS12215 | 2416217..2416324 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAST39_RS12220 | 2416458..2416844 | - | 387 | WP_000779360.1 | flippase GtxA | - |
SAST39_RS12225 | 2417102..2418244 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAST39_RS12230 | 2418304..2418963 | + | 660 | WP_000831295.1 | hypothetical protein | - |
SAST39_RS12235 | 2419145..2420356 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAST39_RS12240 | 2420479..2420952 | - | 474 | WP_000456492.1 | GyrI-like domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T57529 WP_000482647.1 NZ_CP012970:c2416324-2416217 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T57529 NZ_CP012970:c2416324-2416217 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 60 bp
>AT57529 NZ_CP012970:2416141-2416200 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGG
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P7CQJ7 |