Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 941453..941675 | Replicon | chromosome |
Accession | NZ_CP012868 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | QQ24_RS04605 | Protein ID | WP_000141634.1 |
Coordinates | 941568..941675 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 941453..941519 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ24_RS04580 | 936894..937796 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
QQ24_RS04585 | 937807..938790 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
QQ24_RS04590 | 938787..939791 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QQ24_RS04595 | 939821..941092 | - | 1272 | WP_001295225.1 | transporter | - |
- | 941453..941519 | - | 67 | - | - | Antitoxin |
QQ24_RS04605 | 941568..941675 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
QQ24_RS04610 | 941762..943441 | - | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
QQ24_RS04615 | 943438..943629 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
QQ24_RS04620 | 943626..945197 | - | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
QQ24_RS04625 | 945470..945658 | + | 189 | WP_001063318.1 | YhjR family protein | - |
QQ24_RS04630 | 945670..946422 | + | 753 | Protein_852 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T57289 WP_000141634.1 NZ_CP012868:941568-941675 [Escherichia coli str. K-12 substr. MG1655]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T57289 NZ_CP012868:941568-941675 [Escherichia coli str. K-12 substr. MG1655]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT57289 NZ_CP012868:c941519-941453 [Escherichia coli str. K-12 substr. MG1655]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|