Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4314501..4314722 | Replicon | chromosome |
Accession | NZ_CP012802 | ||
Organism | Escherichia coli O157:H7 strain WS4202 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | AO055_RS30735 | Protein ID | WP_001295224.1 |
Coordinates | 4314501..4314608 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4314657..4314722 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AO055_RS22195 | 4309753..4310505 | - | 753 | Protein_4213 | cellulose biosynthesis protein BcsQ | - |
AO055_RS22205 | 4310517..4310706 | - | 190 | Protein_4214 | YhjR family protein | - |
AO055_RS22210 | 4310979..4312550 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
AO055_RS22215 | 4312547..4312738 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
AO055_RS22220 | 4312735..4314414 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
AO055_RS30735 | 4314501..4314608 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4314657..4314722 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4314657..4314722 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4314657..4314722 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4314657..4314722 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 4314657..4314722 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4314657..4314722 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4314657..4314722 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 4314657..4314722 | + | 66 | NuclAT_21 | - | Antitoxin |
AO055_RS22235 | 4315084..4316355 | + | 1272 | WP_001301684.1 | amino acid permease | - |
AO055_RS22240 | 4316385..4317389 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
AO055_RS22245 | 4317386..4318369 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
AO055_RS22250 | 4318380..4319282 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T57239 WP_001295224.1 NZ_CP012802:c4314608-4314501 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T57239 NZ_CP012802:c4314608-4314501 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT57239 NZ_CP012802:4314657-4314722 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|