Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2472629..2472815 | Replicon | chromosome |
Accession | NZ_CP012802 | ||
Organism | Escherichia coli O157:H7 strain WS4202 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | AO055_RS12765 | Protein ID | WP_001459284.1 |
Coordinates | 2472699..2472815 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2472629..2472687 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AO055_RS28795 | 2468883..2468990 | - | 108 | WP_001273654.1 | hypothetical protein | - |
AO055_RS12735 | 2469949..2470578 | + | 630 | WP_000203825.1 | anti-repressor protein | - |
AO055_RS12740 | 2470626..2470847 | + | 222 | WP_000763353.1 | TraR/DksA family transcriptional regulator | - |
AO055_RS12745 | 2470844..2471128 | + | 285 | WP_001024844.1 | DUF4752 family protein | - |
AO055_RS31410 | 2471115..2471584 | + | 470 | Protein_2416 | ead/Ea22-like family protein | - |
AO055_RS31415 | 2471606..2472013 | + | 408 | WP_001120842.1 | DUF551 domain-containing protein | - |
AO055_RS12760 | 2472013..2472408 | + | 396 | WP_000426668.1 | hypothetical protein | - |
- | 2472629..2472687 | - | 59 | - | - | Antitoxin |
AO055_RS12765 | 2472699..2472815 | + | 117 | WP_001459284.1 | Hok/Gef family protein | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | stx2B / stx2A | 2467472..2532549 | 65077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4175.31 Da Isoelectric Point: 10.6248
>T57229 WP_001459284.1 NZ_CP012802:2472699-2472815 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALITKKDLCKGGIPRHL
MKQQKAMLIALIVICLTVIVTALITKKDLCKGGIPRHL
Download Length: 117 bp
>T57229 NZ_CP012802:2472699-2472815 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGATAACGAAGAA
AGACCTCTGCAAGGGAGGAATCCCTCGCCACCTCTGA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGATAACGAAGAA
AGACCTCTGCAAGGGAGGAATCCCTCGCCACCTCTGA
Antitoxin
Download Length: 59 bp
>AT57229 NZ_CP012802:c2472687-2472629 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTTTGTGAAGCATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTTTGTGAAGCATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|