Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 1046057..1046241 | Replicon | chromosome |
| Accession | NZ_CP012756 | ||
| Organism | Staphylococcus aureus strain JS395 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | ACH32_RS05575 | Protein ID | WP_000482647.1 |
| Coordinates | 1046134..1046241 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1046057..1046117 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACH32_RS05555 | 1041643..1041810 | - | 168 | WP_031785511.1 | hypothetical protein | - |
| ACH32_RS05565 | 1042041..1043774 | - | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein/permease | - |
| ACH32_RS05570 | 1043823..1045562 | - | 1740 | WP_001064832.1 | ABC transporter ATP-binding protein/permease | - |
| - | 1046057..1046117 | + | 61 | - | - | Antitoxin |
| ACH32_RS05575 | 1046134..1046241 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| ACH32_RS05580 | 1046375..1046761 | - | 387 | WP_000779354.1 | flippase GtxA | - |
| ACH32_RS05585 | 1047029..1048171 | + | 1143 | WP_001176872.1 | glycerate kinase | - |
| ACH32_RS05590 | 1048231..1048890 | + | 660 | WP_060649688.1 | hypothetical protein | - |
| ACH32_RS05595 | 1049070..1050281 | + | 1212 | WP_001191973.1 | multidrug effflux MFS transporter | - |
| ACH32_RS05600 | 1050404..1050877 | - | 474 | WP_000456490.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sbi / hlgA / hlgA / hlgC / hlgB | 1030943..1046761 | 15818 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T57204 WP_000482647.1 NZ_CP012756:c1046241-1046134 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T57204 NZ_CP012756:c1046241-1046134 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT57204 NZ_CP012756:1046057-1046117 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAAGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAAGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|