Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 376147..376327 | Replicon | chromosome |
Accession | NZ_CP012756 | ||
Organism | Staphylococcus aureus strain JS395 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | ACH32_RS15165 | Protein ID | WP_001801861.1 |
Coordinates | 376147..376242 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 376270..376327 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ACH32_RS01860 | 371184..371810 | + | 627 | WP_000669033.1 | hypothetical protein | - |
ACH32_RS01865 | 371851..372192 | + | 342 | WP_060649610.1 | DUF3969 family protein | - |
ACH32_RS01870 | 372293..372865 | + | 573 | WP_000414203.1 | hypothetical protein | - |
ACH32_RS01875 | 373063..373620 | - | 558 | WP_000864140.1 | ImmA/IrrE family metallo-endopeptidase | - |
ACH32_RS01880 | 373805..373984 | - | 180 | Protein_362 | hypothetical protein | - |
ACH32_RS01885 | 373992..374168 | - | 177 | WP_000375476.1 | hypothetical protein | - |
ACH32_RS01890 | 374179..374562 | - | 384 | WP_025174588.1 | hypothetical protein | - |
ACH32_RS01895 | 375249..375695 | - | 447 | WP_000747807.1 | DUF1433 domain-containing protein | - |
ACH32_RS15165 | 376147..376242 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 376270..376327 | - | 58 | - | - | Antitoxin |
ACH32_RS15370 | 376459..376626 | + | 168 | WP_001268925.1 | hypothetical protein | - |
ACH32_RS01900 | 377252..377695 | - | 444 | WP_000731441.1 | DUF1433 domain-containing protein | - |
ACH32_RS01905 | 377695..378138 | - | 444 | WP_060649611.1 | DUF1433 domain-containing protein | - |
ACH32_RS01910 | 378138..378563 | - | 426 | WP_000260278.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T57196 WP_001801861.1 NZ_CP012756:376147-376242 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T57196 NZ_CP012756:376147-376242 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT57196 NZ_CP012756:c376327-376270 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|