Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3708025..3708250 | Replicon | chromosome |
| Accession | NZ_CP012735 | ||
| Organism | Shigella flexneri 1a strain 0228 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | AOT98_RS20280 | Protein ID | WP_000813254.1 |
| Coordinates | 3708095..3708250 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3708025..3708083 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AOT98_RS30390 | 3704023..3704192 | + | 170 | Protein_3600 | hypothetical protein | - |
| AOT98_RS20240 | 3704338..3705084 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
| AOT98_RS20245 | 3705099..3705521 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
| AOT98_RS20250 | 3705579..3705935 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| AOT98_RS20255 | 3706028..3706246 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| AOT98_RS20260 | 3706248..3706613 | + | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
| AOT98_RS20265 | 3706610..3707275 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| AOT98_RS20270 | 3707275..3707640 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 3708025..3708083 | - | 59 | - | - | Antitoxin |
| AOT98_RS20280 | 3708095..3708250 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| AOT98_RS20295 | 3709587..3710186 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| AOT98_RS20300 | 3710186..3710476 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| AOT98_RS20305 | 3710473..3711027 | + | 555 | Protein_3612 | DUF1133 family protein | - |
| AOT98_RS20310 | 3711180..3711353 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| AOT98_RS20315 | 3711415..3712554 | + | 1140 | WP_000088354.1 | IS3 family transposase | - |
| AOT98_RS20320 | 3712547..3713107 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 3696012..3764878 | 68866 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T57094 WP_000813254.1 NZ_CP012735:3708095-3708250 [Shigella flexneri 1a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T57094 NZ_CP012735:3708095-3708250 [Shigella flexneri 1a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT57094 NZ_CP012735:c3708083-3708025 [Shigella flexneri 1a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|