Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2871435..2871660 | Replicon | chromosome |
Accession | NZ_CP012735 | ||
Organism | Shigella flexneri 1a strain 0228 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | AOT98_RS15610 | Protein ID | WP_000813254.1 |
Coordinates | 2871505..2871660 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2871435..2871493 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AOT98_RS15570 | 2866612..2867874 | - | 1263 | Protein_2730 | tyrosine-type recombinase/integrase | - |
AOT98_RS15580 | 2868212..2869009 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
AOT98_RS15590 | 2869220..2870270 | - | 1051 | Protein_2732 | tyrosine-type recombinase/integrase | - |
AOT98_RS15595 | 2870270..2870410 | - | 141 | Protein_2733 | DUF4224 domain-containing protein | - |
AOT98_RS15600 | 2870437..2870853 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 2871435..2871493 | - | 59 | - | - | Antitoxin |
AOT98_RS15610 | 2871505..2871660 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
AOT98_RS27570 | 2871828..2872106 | + | 279 | WP_011069426.1 | hypothetical protein | - |
AOT98_RS15620 | 2872108..2873166 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
AOT98_RS15625 | 2873167..2873532 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
AOT98_RS15630 | 2873529..2874217 | + | 689 | Protein_2739 | bacteriophage antitermination protein Q | - |
AOT98_RS15655 | 2875013..2875228 | + | 216 | WP_000839572.1 | class II holin family protein | - |
AOT98_RS15660 | 2875327..2876001 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
AOT98_RS15665 | 2875998..2876348 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 2861575..2904287 | 42712 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T57091 WP_000813254.1 NZ_CP012735:2871505-2871660 [Shigella flexneri 1a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T57091 NZ_CP012735:2871505-2871660 [Shigella flexneri 1a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT57091 NZ_CP012735:c2871493-2871435 [Shigella flexneri 1a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|