Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 195872..196141 | Replicon | plasmid pCFSAN004179G |
Accession | NZ_CP012501 | ||
Organism | Escherichia coli strain 08-00022 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CP48_RS01165 | Protein ID | WP_001312861.1 |
Coordinates | 195983..196141 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 195872..195937 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CP48_RS31860 | 191058..191324 | - | 267 | WP_187703271.1 | hypothetical protein | - |
CP48_RS31150 | 191394..191543 | + | 150 | WP_024197809.1 | hypothetical protein | - |
CP48_RS01135 | 191626..192165 | + | 540 | WP_047088942.1 | single-stranded DNA-binding protein | - |
CP48_RS01140 | 192223..192456 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
CP48_RS01145 | 192520..194484 | + | 1965 | Protein_221 | ParB/RepB/Spo0J family partition protein | - |
CP48_RS01150 | 194553..194987 | + | 435 | WP_000845944.1 | conjugation system SOS inhibitor PsiB | - |
CP48_RS01155 | 194984..195703 | + | 720 | WP_000116354.1 | plasmid SOS inhibition protein A | - |
CP48_RS31865 | 195715..195903 | - | 189 | WP_001355331.1 | hypothetical protein | - |
- | 195715..195939 | + | 225 | NuclAT_0 | - | - |
- | 195715..195939 | + | 225 | NuclAT_0 | - | - |
- | 195715..195939 | + | 225 | NuclAT_0 | - | - |
- | 195715..195939 | + | 225 | NuclAT_0 | - | - |
- | 195872..195937 | + | 66 | - | - | Antitoxin |
CP48_RS01165 | 195983..196141 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CP48_RS31155 | 196589..196834 | + | 246 | WP_187703272.1 | hypothetical protein | - |
CP48_RS01175 | 197190..198194 | - | 1005 | WP_024166184.1 | IS110 family transposase | - |
CP48_RS01180 | 198445..198732 | + | 288 | WP_000107542.1 | hypothetical protein | - |
CP48_RS31165 | 198851..199672 | + | 822 | Protein_229 | DUF945 domain-containing protein | - |
CP48_RS30255 | 199970..200479 | - | 510 | Protein_230 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | estIa / faeC / faeD / faeE / faeF / faeH / faeI / faeJ / stcE / exeE / exeG / hlyD / hlyB / hlyA / hlyC / estIa / estIa | 1..242187 | 242187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T56532 WP_001312861.1 NZ_CP012501:195983-196141 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T56532 NZ_CP012501:195983-196141 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT56532 NZ_CP012501:195872-195937 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|