Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38184..38437 | Replicon | plasmid pCFSAN004180G |
| Accession | NZ_CP012500 | ||
| Organism | Escherichia coli strain 09-00049 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | GJ12_RS00235 | Protein ID | WP_001312851.1 |
| Coordinates | 38184..38333 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 38381..38437 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GJ12_RS00205 | 33700..34164 | - | 465 | WP_040090730.1 | hypothetical protein | - |
| GJ12_RS00210 | 34443..35483 | - | 1041 | WP_136759863.1 | hypothetical protein | - |
| GJ12_RS00220 | 36484..37341 | - | 858 | WP_000829162.1 | incFII family plasmid replication initiator RepA | - |
| GJ12_RS00225 | 37334..37408 | - | 75 | WP_001364037.1 | RepA leader peptide Tap | - |
| GJ12_RS00230 | 37652..37900 | - | 249 | WP_000083838.1 | replication regulatory protein RepA | - |
| GJ12_RS00235 | 38184..38333 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 38381..38437 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 38381..38437 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 38381..38437 | + | 57 | NuclAT_1 | - | Antitoxin |
| - | 38381..38437 | + | 57 | NuclAT_1 | - | Antitoxin |
| GJ12_RS00240 | 38589..39053 | - | 465 | WP_000455478.1 | hypothetical protein | - |
| GJ12_RS00245 | 39208..39798 | - | 591 | WP_000766788.1 | DUF2726 domain-containing protein | - |
| GJ12_RS00250 | 39836..40045 | - | 210 | WP_001355319.1 | hemolysin expression modulator Hha | - |
| GJ12_RS00255 | 40373..40585 | - | 213 | WP_001364091.1 | hypothetical protein | - |
| GJ12_RS00260 | 40720..41280 | - | 561 | WP_000139355.1 | fertility inhibition protein FinO | - |
| GJ12_RS00265 | 41335..42072 | - | 738 | WP_000429592.1 | conjugal transfer pilus acetylase TraX | - |
| GJ12_RS00270 | 42094..42525 | - | 432 | WP_000447372.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyD / hlyB / hlyA / hlyC / estIa / estIa / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..225292 | 225292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T56513 WP_001312851.1 NZ_CP012500:c38333-38184 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T56513 NZ_CP012500:c38333-38184 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCTGTGTGCGCTACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCTGTGTGCGCTACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT56513 NZ_CP012500:38381-38437 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATCTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|