Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2504284..2504464 | Replicon | chromosome |
Accession | NZ_CP012409 | ||
Organism | Staphylococcus aureus subsp. aureus Tager 104 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | Tgr_RS15325 | Protein ID | WP_001801861.1 |
Coordinates | 2504369..2504464 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2504284..2504341 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
Tgr_RS12675 | 2502099..2502542 | + | 444 | WP_000747798.1 | DUF1433 domain-containing protein | - |
Tgr_RS12680 | 2502542..2502985 | + | 444 | WP_000731420.1 | DUF1433 domain-containing protein | - |
Tgr_RS12685 | 2502985..2503428 | + | 444 | WP_000728661.1 | DUF1433 domain-containing protein | - |
Tgr_RS15365 | 2503998..2504153 | - | 156 | WP_001215823.1 | hypothetical protein | - |
- | 2504284..2504341 | + | 58 | - | - | Antitoxin |
Tgr_RS15325 | 2504369..2504464 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
Tgr_RS12690 | 2504609..2504845 | + | 237 | WP_000251969.1 | IS3 family transposase | - |
Tgr_RS12695 | 2504851..2505084 | + | 234 | Protein_2402 | IS3 family transposase | - |
Tgr_RS12700 | 2505252..2505541 | + | 290 | Protein_2403 | hypothetical protein | - |
Tgr_RS12705 | 2505552..2505728 | + | 177 | WP_000375478.1 | hypothetical protein | - |
Tgr_RS12710 | 2505730..2505915 | + | 186 | WP_000809860.1 | hypothetical protein | - |
Tgr_RS12715 | 2506246..2506818 | - | 573 | WP_000414218.1 | hypothetical protein | - |
Tgr_RS12720 | 2506919..2507260 | - | 342 | WP_000627534.1 | DUF3969 family protein | - |
Tgr_RS12725 | 2507301..2507927 | - | 627 | WP_000669045.1 | hypothetical protein | - |
Tgr_RS12730 | 2508003..2508998 | - | 996 | WP_020977362.1 | DUF4352 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2504609..2504845 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T56446 WP_001801861.1 NZ_CP012409:c2504464-2504369 [Staphylococcus aureus subsp. aureus Tager 104]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T56446 NZ_CP012409:c2504464-2504369 [Staphylococcus aureus subsp. aureus Tager 104]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT56446 NZ_CP012409:2504284-2504341 [Staphylococcus aureus subsp. aureus Tager 104]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|