Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1880466..1880650 | Replicon | chromosome |
Accession | NZ_CP012409 | ||
Organism | Staphylococcus aureus subsp. aureus Tager 104 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | Tgr_RS09205 | Protein ID | WP_000482647.1 |
Coordinates | 1880466..1880573 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1880590..1880650 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
Tgr_RS09180 | 1875827..1876300 | + | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Tgr_RS09185 | 1876423..1877634 | - | 1212 | WP_001191923.1 | multidrug effflux MFS transporter | - |
Tgr_RS09190 | 1877817..1878476 | - | 660 | WP_000831298.1 | membrane protein | - |
Tgr_RS09195 | 1878536..1879678 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
Tgr_RS09200 | 1879946..1880332 | + | 387 | WP_000779352.1 | flippase GtxA | - |
Tgr_RS09205 | 1880466..1880573 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1880590..1880650 | - | 61 | - | - | Antitoxin |
Tgr_RS15355 | 1880600..1880767 | + | 168 | WP_000301893.1 | hypothetical protein | - |
Tgr_RS09210 | 1881296..1883059 | + | 1764 | WP_001064819.1 | ABC transporter ATP-binding protein/permease | - |
Tgr_RS09215 | 1883084..1884815 | + | 1732 | Protein_1764 | ABC transporter ATP-binding protein | - |
Tgr_RS09225 | 1885046..1885213 | + | 168 | WP_001789205.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T56433 WP_000482647.1 NZ_CP012409:1880466-1880573 [Staphylococcus aureus subsp. aureus Tager 104]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T56433 NZ_CP012409:1880466-1880573 [Staphylococcus aureus subsp. aureus Tager 104]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT56433 NZ_CP012409:c1880650-1880590 [Staphylococcus aureus subsp. aureus Tager 104]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|