Detailed information of TA system TA056390

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1345064..1345284
• Replicon: chromosome
• Accession: NZ_CP012380
• Organism: Escherichia coli strain WAT

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: AKO64_RS06965
• Protein ID: WP_000170965.1
• Coordinates: 1345064..1345171 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1345218..1345284 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AKO64_RS06930	1340919..1341752	+	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-
AKO64_RS06935	1341749..1342141	+	393	WP_000200378.1	invasion regulator SirB2	-
AKO64_RS06940	1342145..1342954	+	810	WP_001257044.1	invasion regulator SirB1	-
AKO64_RS06945	1342990..1343844	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
AKO64_RS06950	1343993..1344100	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	1344148..1344214	+	67	NuclAT_44	-	-
-	1344148..1344214	+	67	NuclAT_44	-	-
-	1344148..1344214	+	67	NuclAT_44	-	-
-	1344148..1344214	+	67	NuclAT_44	-	-
-	1344148..1344214	+	67	NuclAT_47	-	-
-	1344148..1344214	+	67	NuclAT_47	-	-
-	1344148..1344214	+	67	NuclAT_47	-	-
-	1344148..1344214	+	67	NuclAT_47	-	-
-	1344148..1344214	+	67	NuclAT_50	-	-
-	1344148..1344214	+	67	NuclAT_50	-	-
-	1344148..1344214	+	67	NuclAT_50	-	-
-	1344148..1344214	+	67	NuclAT_50	-	-
-	1344150..1344213	+	64	NuclAT_16	-	-
-	1344150..1344213	+	64	NuclAT_16	-	-
-	1344150..1344213	+	64	NuclAT_16	-	-
-	1344150..1344213	+	64	NuclAT_16	-	-
-	1344150..1344213	+	64	NuclAT_19	-	-
-	1344150..1344213	+	64	NuclAT_19	-	-
-	1344150..1344213	+	64	NuclAT_19	-	-
-	1344150..1344213	+	64	NuclAT_19	-	-
-	1344150..1344213	+	64	NuclAT_22	-	-
-	1344150..1344213	+	64	NuclAT_22	-	-
-	1344150..1344213	+	64	NuclAT_22	-	-
-	1344150..1344213	+	64	NuclAT_22	-	-
-	1344150..1344213	+	64	NuclAT_25	-	-
-	1344150..1344213	+	64	NuclAT_25	-	-
-	1344150..1344213	+	64	NuclAT_25	-	-
-	1344150..1344213	+	64	NuclAT_25	-	-
-	1344150..1344213	+	64	NuclAT_28	-	-
-	1344150..1344213	+	64	NuclAT_28	-	-
-	1344150..1344213	+	64	NuclAT_28	-	-
-	1344150..1344213	+	64	NuclAT_28	-	-
-	1344150..1344213	+	64	NuclAT_31	-	-
-	1344150..1344213	+	64	NuclAT_31	-	-
-	1344150..1344213	+	64	NuclAT_31	-	-
-	1344150..1344213	+	64	NuclAT_31	-	-
AKO64_RS06960	1344528..1344635	-	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	1344688..1344749	+	62	NuclAT_15	-	-
-	1344688..1344749	+	62	NuclAT_15	-	-
-	1344688..1344749	+	62	NuclAT_15	-	-
-	1344688..1344749	+	62	NuclAT_15	-	-
-	1344688..1344749	+	62	NuclAT_18	-	-
-	1344688..1344749	+	62	NuclAT_18	-	-
-	1344688..1344749	+	62	NuclAT_18	-	-
-	1344688..1344749	+	62	NuclAT_18	-	-
-	1344688..1344749	+	62	NuclAT_21	-	-
-	1344688..1344749	+	62	NuclAT_21	-	-
-	1344688..1344749	+	62	NuclAT_21	-	-
-	1344688..1344749	+	62	NuclAT_21	-	-
-	1344688..1344749	+	62	NuclAT_24	-	-
-	1344688..1344749	+	62	NuclAT_24	-	-
-	1344688..1344749	+	62	NuclAT_24	-	-
-	1344688..1344749	+	62	NuclAT_24	-	-
-	1344688..1344749	+	62	NuclAT_27	-	-
-	1344688..1344749	+	62	NuclAT_27	-	-
-	1344688..1344749	+	62	NuclAT_27	-	-
-	1344688..1344749	+	62	NuclAT_27	-	-
-	1344688..1344749	+	62	NuclAT_30	-	-
-	1344688..1344749	+	62	NuclAT_30	-	-
-	1344688..1344749	+	62	NuclAT_30	-	-
-	1344688..1344749	+	62	NuclAT_30	-	-
-	1344688..1344750	+	63	NuclAT_45	-	-
-	1344688..1344750	+	63	NuclAT_45	-	-
-	1344688..1344750	+	63	NuclAT_45	-	-
-	1344688..1344750	+	63	NuclAT_45	-	-
-	1344688..1344750	+	63	NuclAT_48	-	-
-	1344688..1344750	+	63	NuclAT_48	-	-
-	1344688..1344750	+	63	NuclAT_48	-	-
-	1344688..1344750	+	63	NuclAT_48	-	-
-	1344688..1344750	+	63	NuclAT_51	-	-
-	1344688..1344750	+	63	NuclAT_51	-	-
-	1344688..1344750	+	63	NuclAT_51	-	-
-	1344688..1344750	+	63	NuclAT_51	-	-
-	1344688..1344751	+	64	NuclAT_33	-	-
-	1344688..1344751	+	64	NuclAT_33	-	-
-	1344688..1344751	+	64	NuclAT_33	-	-
-	1344688..1344751	+	64	NuclAT_33	-	-
-	1344688..1344751	+	64	NuclAT_35	-	-
-	1344688..1344751	+	64	NuclAT_35	-	-
-	1344688..1344751	+	64	NuclAT_35	-	-
-	1344688..1344751	+	64	NuclAT_35	-	-
-	1344688..1344751	+	64	NuclAT_37	-	-
-	1344688..1344751	+	64	NuclAT_37	-	-
-	1344688..1344751	+	64	NuclAT_37	-	-
-	1344688..1344751	+	64	NuclAT_37	-	-
-	1344688..1344751	+	64	NuclAT_39	-	-
-	1344688..1344751	+	64	NuclAT_39	-	-
-	1344688..1344751	+	64	NuclAT_39	-	-
-	1344688..1344751	+	64	NuclAT_39	-	-
-	1344688..1344751	+	64	NuclAT_41	-	-
-	1344688..1344751	+	64	NuclAT_41	-	-
-	1344688..1344751	+	64	NuclAT_41	-	-
-	1344688..1344751	+	64	NuclAT_41	-	-
-	1344688..1344751	+	64	NuclAT_43	-	-
-	1344688..1344751	+	64	NuclAT_43	-	-
-	1344688..1344751	+	64	NuclAT_43	-	-
-	1344688..1344751	+	64	NuclAT_43	-	-
AKO64_RS06965	1345064..1345171	-	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1345218..1345284	+	67	-	-	Antitoxin
AKO64_RS06975	1345576..1346676	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
AKO64_RS06980	1346946..1347176	+	231	WP_001146442.1	putative cation transport regulator ChaB	-
AKO64_RS06985	1347334..1348029	+	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
AKO64_RS06990	1348073..1348426	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
AKO64_RS06995	1348611..1350005	+	1395	WP_000086201.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T56390 WP_000170965.1 NZ_CP012380:c1345171-1345064 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T56390 NZ_CP012380:c1345171-1345064 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT56390 NZ_CP012380:1345218-1345284 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin