Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 1344528..1344749 | Replicon | chromosome |
Accession | NZ_CP012380 | ||
Organism | Escherichia coli strain WAT |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | E0IV43 |
Locus tag | AKO64_RS06960 | Protein ID | WP_000170926.1 |
Coordinates | 1344528..1344635 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 1344688..1344749 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AKO64_RS06925 | 1339837..1340919 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
AKO64_RS06930 | 1340919..1341752 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
AKO64_RS06935 | 1341749..1342141 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
AKO64_RS06940 | 1342145..1342954 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
AKO64_RS06945 | 1342990..1343844 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
AKO64_RS06950 | 1343993..1344100 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1344148..1344214 | + | 67 | NuclAT_44 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_44 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_44 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_44 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_47 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_47 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_47 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_47 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_50 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_50 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_50 | - | - |
- | 1344148..1344214 | + | 67 | NuclAT_50 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_16 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_16 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_16 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_16 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_19 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_19 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_19 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_19 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_22 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_22 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_22 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_22 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_25 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_25 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_25 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_25 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_28 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_28 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_28 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_28 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_31 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_31 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_31 | - | - |
- | 1344150..1344213 | + | 64 | NuclAT_31 | - | - |
AKO64_RS06960 | 1344528..1344635 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1344688..1344749 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_15 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_18 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_18 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_18 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_18 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_21 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_21 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_21 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_21 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_24 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_24 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_24 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_24 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_27 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_27 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_27 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_27 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_30 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_30 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_30 | - | Antitoxin |
- | 1344688..1344749 | + | 62 | NuclAT_30 | - | Antitoxin |
- | 1344688..1344750 | + | 63 | NuclAT_45 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_45 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_45 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_45 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_48 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_48 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_48 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_48 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_51 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_51 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_51 | - | - |
- | 1344688..1344750 | + | 63 | NuclAT_51 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_33 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_33 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_33 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_33 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_35 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_35 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_35 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_35 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_37 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_37 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_37 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_37 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_39 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_39 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_39 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_39 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_41 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_41 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_41 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_41 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_43 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_43 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_43 | - | - |
- | 1344688..1344751 | + | 64 | NuclAT_43 | - | - |
AKO64_RS06965 | 1345064..1345171 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1345219..1345284 | + | 66 | NuclAT_14 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_14 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_14 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_14 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_17 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_17 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_17 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_17 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_20 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_20 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_20 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_20 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_23 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_23 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_23 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_23 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_26 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_26 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_26 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_26 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_29 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_29 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_29 | - | - |
- | 1345219..1345284 | + | 66 | NuclAT_29 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_32 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_32 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_32 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_32 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_34 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_34 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_34 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_34 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_36 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_36 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_36 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_36 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_38 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_38 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_38 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_38 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_40 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_40 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_40 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_40 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_42 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_42 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_42 | - | - |
- | 1345219..1345286 | + | 68 | NuclAT_42 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_46 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_46 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_46 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_46 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_49 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_49 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_49 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_49 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_52 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_52 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_52 | - | - |
- | 1345220..1345285 | + | 66 | NuclAT_52 | - | - |
AKO64_RS06975 | 1345576..1346676 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
AKO64_RS06980 | 1346946..1347176 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
AKO64_RS06985 | 1347334..1348029 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
AKO64_RS06990 | 1348073..1348426 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T56386 WP_000170926.1 NZ_CP012380:c1344635-1344528 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T56386 NZ_CP012380:c1344635-1344528 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT56386 NZ_CP012380:1344688-1344749 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|