Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1849870..1850095 | Replicon | chromosome |
Accession | NZ_CP012140 | ||
Organism | Shigella flexneri 4c strain 1205 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | AD871_RS10335 | Protein ID | WP_000813254.1 |
Coordinates | 1849870..1850025 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1850037..1850095 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AD871_RS10290 | 1845013..1845495 | - | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
AD871_RS10295 | 1845566..1846705 | - | 1140 | WP_000088354.1 | IS3 family transposase | - |
AD871_RS10300 | 1846767..1846940 | - | 174 | WP_000504450.1 | hypothetical protein | - |
AD871_RS10305 | 1847093..1847647 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
AD871_RS10310 | 1847644..1847934 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
AD871_RS10315 | 1847934..1848533 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
AD871_RS28825 | 1848667..1849364 | + | 698 | WP_227804315.1 | IS1 family transposase | - |
AD871_RS10335 | 1849870..1850025 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 1850037..1850095 | + | 59 | - | - | Antitoxin |
AD871_RS10345 | 1850480..1850845 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
AD871_RS10350 | 1850845..1851510 | - | 666 | WP_000208062.1 | hypothetical protein | - |
AD871_RS10355 | 1851507..1851872 | - | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
AD871_RS10360 | 1851874..1852092 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
AD871_RS10365 | 1852185..1852541 | - | 357 | WP_005048249.1 | hypothetical protein | - |
AD871_RS10370 | 1852599..1853021 | - | 423 | WP_001118168.1 | DUF977 family protein | - |
AD871_RS10375 | 1853036..1853782 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
AD871_RS30500 | 1853928..1854097 | - | 170 | Protein_1883 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 1796158..1858012 | 61854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T56011 WP_000813254.1 NZ_CP012140:c1850025-1849870 [Shigella flexneri 4c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T56011 NZ_CP012140:c1850025-1849870 [Shigella flexneri 4c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT56011 NZ_CP012140:1850037-1850095 [Shigella flexneri 4c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|