Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1172250..1172475 | Replicon | chromosome |
Accession | NZ_CP012140 | ||
Organism | Shigella flexneri 4c strain 1205 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | AD871_RS06310 | Protein ID | WP_000813254.1 |
Coordinates | 1172320..1172475 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1172250..1172308 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AD871_RS06270 | 1167427..1168689 | - | 1263 | Protein_1140 | tyrosine-type recombinase/integrase | - |
AD871_RS06280 | 1169027..1169824 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
AD871_RS06290 | 1170035..1171085 | - | 1051 | Protein_1142 | tyrosine-type recombinase/integrase | - |
AD871_RS06295 | 1171085..1171225 | - | 141 | Protein_1143 | DUF4224 domain-containing protein | - |
AD871_RS06300 | 1171252..1171668 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 1172250..1172308 | - | 59 | - | - | Antitoxin |
AD871_RS06310 | 1172320..1172475 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
AD871_RS06320 | 1172643..1172921 | + | 279 | WP_011069426.1 | hypothetical protein | - |
AD871_RS06325 | 1172923..1173981 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
AD871_RS06330 | 1173982..1174347 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
AD871_RS06335 | 1174344..1175032 | + | 689 | Protein_1149 | bacteriophage antitermination protein Q | - |
AD871_RS06360 | 1175828..1176043 | + | 216 | WP_000839572.1 | class II holin family protein | - |
AD871_RS06365 | 1176142..1176816 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
AD871_RS06370 | 1176813..1177163 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 1133896..1205102 | 71206 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T56000 WP_000813254.1 NZ_CP012140:1172320-1172475 [Shigella flexneri 4c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T56000 NZ_CP012140:1172320-1172475 [Shigella flexneri 4c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT56000 NZ_CP012140:c1172308-1172250 [Shigella flexneri 4c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|