Detailed information of TA system TA055994

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 43930..44199
• Replicon: plasmid 981p2
• Accession: NZ_CP012139
• Organism: Shigella flexneri 2a strain 981

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: AD867_RS26205
• Protein ID: WP_001372321.1
• Coordinates: 44074..44199 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	43930..43995 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AD867_RS26175 (39640)	39640..40167	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
AD867_RS26180 (40225)	40225..40458	+	234	WP_000006003.1	DUF905 family protein	-
AD867_RS26185 (40519)	40519..42542	+	2024	Protein_51	ParB/RepB/Spo0J family partition protein	-
AD867_RS26190 (42611)	42611..43045	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
AD867_RS26195 (43042)	43042..43761	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
AD867_RS31005 (43782)	43782..43961	-	180	WP_001309233.1	hypothetical protein	-
- (43929)	43929..43992	-	64	NuclAT_1	-	-
- (43929)	43929..43992	-	64	NuclAT_1	-	-
- (43930)	43930..43995	+	66	NuclAT_0	-	Antitoxin
- (43930)	43930..43995	+	66	NuclAT_0	-	Antitoxin
- (43930)	43930..43995	+	66	NuclAT_1	-	Antitoxin
- (43773)	43773..43997	+	225	NuclAT_0	-	-
- (43773)	43773..43997	+	225	NuclAT_0	-	-
- (43773)	43773..43997	+	225	NuclAT_0	-	-
- (43773)	43773..43997	+	225	NuclAT_0	-	-
- (43773)	43773..43997	-	225	NuclAT_0	-	-
AD867_RS31675 (43983)	43983..44132	+	150	Protein_55	plasmid maintenance protein Mok	-
AD867_RS26205 (44074)	44074..44199	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
AD867_RS31680 (44518)	44518..44814	-	297	Protein_57	hypothetical protein	-
AD867_RS26215 (45114)	45114..45410	+	297	WP_001272251.1	hypothetical protein	-
AD867_RS26220 (45521)	45521..46342	+	822	WP_001234445.1	DUF932 domain-containing protein	-
AD867_RS26225 (46639)	46639..47229	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
AD867_RS26230 (47564)	47564..47947	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
AD867_RS26235 (48141)	48141..48812	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
AD867_RS26240 (48949)	48949..49176	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T55994 WP_001372321.1 NZ_CP012139:44074-44199 [Shigella flexneri 2a]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T55994 NZ_CP012139:44074-44199 [Shigella flexneri 2a]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT55994 NZ_CP012139:43930-43995 [Shigella flexneri 2a]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin