Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2111395..2111620 | Replicon | chromosome |
Accession | NZ_CP012137 | ||
Organism | Shigella flexneri 2a strain 981 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | AD867_RS11730 | Protein ID | WP_000813254.1 |
Coordinates | 2111395..2111550 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2111562..2111620 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AD867_RS11675 | 2106707..2107057 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
AD867_RS11680 | 2107054..2107728 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
AD867_RS11685 | 2107827..2108042 | - | 216 | WP_000839572.1 | class II holin family protein | - |
AD867_RS11710 | 2108838..2109526 | - | 689 | Protein_2145 | bacteriophage antitermination protein Q | - |
AD867_RS11715 | 2109523..2109888 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
AD867_RS11720 | 2109889..2110947 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
AD867_RS27835 | 2110949..2111227 | - | 279 | WP_011069426.1 | hypothetical protein | - |
AD867_RS11730 | 2111395..2111550 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2111562..2111620 | + | 59 | - | - | Antitoxin |
AD867_RS11740 | 2112201..2112617 | - | 417 | WP_005069274.1 | hypothetical protein | - |
AD867_RS11745 | 2112644..2112784 | + | 141 | Protein_2151 | DUF4224 domain-containing protein | - |
AD867_RS11750 | 2112784..2113834 | + | 1051 | Protein_2152 | tyrosine-type recombinase/integrase | - |
AD867_RS11760 | 2114045..2114842 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
AD867_RS11770 | 2115180..2116442 | + | 1263 | Protein_2154 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 2093218..2149971 | 56753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T55984 WP_000813254.1 NZ_CP012137:c2111550-2111395 [Shigella flexneri 2a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T55984 NZ_CP012137:c2111550-2111395 [Shigella flexneri 2a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT55984 NZ_CP012137:2111562-2111620 [Shigella flexneri 2a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|